• Gene id: 64422

Gene Summary

• Gene Symbol: ATG3   Gene   UCSC   Ensembl
• Aliases: APG3, APG3-LIKE, APG3L, PC3-96
• Gene name: autophagy related 3
• Alternate names: ubiquitin-like-conjugating enzyme ATG3, 2610016C12Rik, APG3 autophagy 3-like, ATG3 autophagy related 3 homolog, autophagy-related protein 3, hApg3,
• Gene location: 3q13.2 (112561961: 112532509)     Exons: 12     NC_000003.12
• Gene summary(Entrez): This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to pla
• OMIM: 609606

Protein Summary

• Protein general information: Q9NT62  
  • Name: Ubiquitin like conjugating enzyme ATG3 (EC 2.3.2. ) (Autophagy related protein 3) (APG3 like) (hApg3) (Protein PC3 96)
  • Length: 314  
  • Mass: 35864
  • Tissue specificity: Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta. {ECO
• Sequence:

  MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLV
  TKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDED
  EGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQ
  PLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAV
  IPTIEYDYTRHFTM

• Structural information:
  • Interpro: IPR007135  IPR019461  IPR007134  
  • PDB: 4NAW
  • PDBsum: 4NAW
  • DIP: 35052
  • STRING: ENSP00000283290
• Other Databases: GeneCards:  ATG3  Malacards:  ATG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0044804	autophagy of nucleus	IBA	biological process
GO:0019776	Atg8 ligase activity	IBA	molecular function
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0000153	cytoplasmic ubiquitin ligase complex	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:1902017	regulation of cilium assembly	ISS	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	ISS	biological process
GO:0019777	Atg12 transferase activity	ISS	molecular function
GO:0019776	Atg8 ligase activity	ISS	molecular function
GO:0000045	autophagosome assembly	ISS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0006464	cellular protein modification process	IDA	biological process
GO:0019787	ubiquitin-like protein transferase activity	IDA	molecular function
GO:0000153	cytoplasmic ubiquitin ligase complex	IPI	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IEA	biological process
GO:0050765	negative regulation of phagocytosis	IEA	biological process
GO:1902017	regulation of cilium assembly	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0000045	autophagosome assembly	IEA	biological process
GO:0016236	macroautophagy	IEA	biological process
GO:0019776	Atg8 ligase activity	IEA	molecular function
GO:0019777	Atg12 transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0006612	protein targeting to membrane	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	ISS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray