• Gene id: 644150

Gene Summary

• Gene Symbol: WIPF3   Gene   UCSC   Ensembl
• Aliases: CR16
• Gene name: WAS/WASL interacting protein family member 3
• Alternate names: WAS/WASL-interacting protein family member 3, corticosteroids and regional expression protein 16 homolog,
• Gene location: 7p14.3 (29806553: 29917065)     Exons: 10     NC_000007.14
• OMIM: 612432

Protein Summary

• Protein general information: A6NGB9  
  • Name: WAS/WASL interacting protein family member 3 (Corticosteroids and regional expression protein 16 homolog)
  • Length: 483  
  • Mass: 49,458
• Sequence:

  MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLRRADPKGRSALLADIQQGTRLRKVTQINDRSAPQIES
  SKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASP
  RLGNTSEAHGAARTAPPRPNVPAPPPPTPPPPPPPLPPPLPSSSPIKTPLVSPPGPLTKGNLPVVAPPVPCAPPP
  PPPPPPPTPPPLPPASVLSDKAVKPQLAPLHLPPIPPPLPLLPPCGYPGLKAEPASPAQDAQEPPAPPPPLPPYA
  SCSPRASLPAPPLPGVNSSSETPPPLPPKSPSFQAPPQKAGAQALPAPPAPPGSQPFLQKKRHGRPGAGGGKLNP
  PPAPPARSPTTELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFESKFTFHSVEDFPPPDEYKPCQKIYPSKIPR
  SRTPGPWLQAEAVGQSSDDIKGRNSQLSLKTLR

• Structural information:
  • Protein Domains: WH2. (45-62)
  • Interpro: IPR003124  
  • Prosite: PS51082
  • STRING: ENSP00000386878
• Other Databases: GeneCards:  WIPF3  Malacards:  WIPF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005884	actin filament	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0030048	actin filament-based movement	IBA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0051127	positive regulation of actin nucleation	IBA	biological process
GO:0000147	actin cortical patch assembly	IBA	biological process
GO:0030479	actin cortical patch	IBA	cellular component
GO:0051666	actin cortical patch localization	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005884	actin filament	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0030048	actin filament-based movement	IBA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0051127	positive regulation of actin nucleation	IBA	biological process
GO:0000147	actin cortical patch assembly	IBA	biological process
GO:0030479	actin cortical patch	IBA	cellular component
GO:0051666	actin cortical patch localization	IBA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005884	actin filament	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0030048	actin filament-based movement	IBA	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0051127	positive regulation of actin nucleation	IBA	biological process
GO:0000147	actin cortical patch assembly	IBA	biological process
GO:0030479	actin cortical patch	IBA	cellular component
GO:0051666	actin cortical patch localization	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05130	Pathogenic Escherichia coli infection
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Azoospermia	MIK: 21503600
Male factor infertility	MIK: 21348202
Azoospermia	MIK: 21503600
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21503600	Idiopathic azoospermia				Male infertility	CR16
21348202	Idiopathic azoospermia			58 (48 patients with idiopathic azoospermia, 10 healthy men)	Male infertility	CR16
17573773	Role in spermatogenesis				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R