• Gene id: 644096

Gene Summary

• Gene Symbol: SDHAF1   Gene   UCSC   Ensembl
• Aliases: LYRM8
• Gene name: succinate dehydrogenase complex assembly factor 1
• Alternate names: succinate dehydrogenase assembly factor 1, mitochondrial, LYR motif containing 8, LYR motif-containing protein 8, SDH assembly factor 1,
• Gene location: 19q13.12 (35995187: 35996311)     Exons: 1     NC_000019.10
• Gene summary(Entrez): The succinate dehydrogenase (SDH) complex (or complex II) of the mitochondrial respiratory chain is composed of 4 individual subunits. The protein encoded by this gene resides in the mitochondria, and is essential for SDH assembly, but does not physically
• OMIM: 602805

Protein Summary

• Protein general information: A6NFY7  
  • Name: Succinate dehydrogenase assembly factor 1, mitochondrial (SDH assembly factor 1) (SDHAF1) (LYR motif containing protein 8)
  • Length: 115  
  • Mass: 12806
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAF
  VRPRAPTGEPGGVGCQPDDGDSPRNPHDSTGAPETRPDGR

• Structural information:
  • Interpro: IPR008011  
  • DIP: 62123
  • STRING: ENSP00000368165
• Other Databases: GeneCards:  SDHAF1  Malacards:  SDHAF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034553	mitochondrial respiratory chain complex II assembly	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0034553	mitochondrial respiratory chain complex II assembly	IMP	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component

Diseases

Associated diseases	References
Mitochondrial complex II deficiency	KEGG:H02005
Mitochondrial complex II deficiency	KEGG:H02005
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray