• Gene id: 64393

Gene Summary

• Gene Symbol: ZMAT3   Gene   UCSC   Ensembl
• Aliases: PAG608, WIG-1, WIG1
• Gene name: zinc finger matrin-type 3
• Alternate names: zinc finger matrin-type protein 3, WIG-1/PAG608 protein, p53 target zinc finger protein, p53-activated gene 608 protein, zinc finger protein WIG1,
• Gene location: 3q26.32 (179072512: 179017222)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene
• OMIM: 606452

Protein Summary

• Protein general information: Q9HA38  
  • Name: Zinc finger matrin type protein 3 (Zinc finger protein WIG 1) (p53 activated gene 608 protein)
  • Length: 289  
  • Mass: 32059
  • Tissue specificity: Highly expressed in adult brain, and moderately in adult kidney and testis. Not detected in fetal brain, heart, pancreas, adrenal gland, liver or small intestine. {ECO
• Sequence:

  MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPLYCKLC
  NVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRVILATENDYCK
  LCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFN
  PRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV

• Structural information:
  • Interpro: IPR003604  IPR022755  IPR036236  IPR013087  
  • STRING: ENSP00000311221
• Other Databases: GeneCards:  ZMAT3  Malacards:  ZMAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881