• Gene id: 6439

Gene Summary

• Gene Symbol: SFTPB   Gene   UCSC   Ensembl
• Aliases: PSP-B, SFTB3, SFTP3, SMDP1, SP-B
• Gene name: surfactant protein B
• Alternate names: pulmonary surfactant-associated protein B, 18 kDa pulmonary-surfactant protein, 6 kDa protein, pulmonary surfactant-associated proteolipid SPL(Phe),
• Gene location: 2p11.2 (85668740: 85657306)     Exons: 14     NC_000002.12
• Gene summary(Entrez): This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% p
• OMIM: 178640

Protein Summary

• Protein general information: P07988  
  • Name: Pulmonary surfactant associated protein B (SP B) (18 kDa pulmonary surfactant protein) (6 kDa protein) (Pulmonary surfactant associated proteolipid SPL(Phe))
  • Length: 381  
  • Mass: 42117
• Sequence:

  MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDI
  VHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEP
  EQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKG
  ALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH
  LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQC
  IHSPDL

• Structural information:
  • Protein Domains: (25..6-)
    (/note="Saposin-A-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00414-)
    (65..14-)
    1 (/note="Saposin-B-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00415-)
    (204..28-)
    2 (/note="Saposin-B-type)
    (/evidence="ECO:0000255|PR-)
  • Interpro: IPR003119  IPR007856  IPR008138  IPR008373  IPR011001   IPR008139  
  • Prosite: PS51110 PS50015
  • PDB: 1DFW 1KMR 1RG3 1RG4 1SSZ 2DWF 2JOU 2M0H 2M1T
  • PDBsum: 1DFW 1KMR 1RG3 1RG4 1SSZ 2DWF 2JOU 2M0H 2M1T
  • STRING: ENSP00000386346
• Other Databases: GeneCards:  SFTPB  Malacards:  SFTPB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007585	respiratory gaseous exchange by respiratory system	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0042599	lamellar body	TAS	cellular component
GO:0042599	lamellar body	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0097486	multivesicular body lumen	TAS	cellular component
GO:0097486	multivesicular body lumen	TAS	cellular component
GO:0097486	multivesicular body lumen	TAS	cellular component
GO:0097486	multivesicular body lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0045334	clathrin-coated endocytic vesicle	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0097208	alveolar lamellar body	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005771	multivesicular body	IBA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007585	respiratory gaseous exchange by respiratory system	IEA	biological process

Diseases

Associated diseases	References
Congenital pulmonary alveolar proteinosis	KEGG:H01122
Congenital pulmonary alveolar proteinosis	KEGG:H01122
Adult respiratory distress syndrome	PMID:9351625
Adult respiratory distress syndrome	PMID:17662121
Adult respiratory distress syndrome	PMID:15190959
Adult respiratory distress syndrome	PMID:14718442
pulmonary alveolar proteinosis	PMID:12612307
pulmonary alveolar proteinosis	PMID:16042774
newborn respiratory distress syndrome	PMID:18353230
newborn respiratory distress syndrome	PMID:12490037
newborn respiratory distress syndrome	PMID:7832777
newborn respiratory distress syndrome	PMID:12424586
newborn respiratory distress syndrome	PMID:11063734
Cystic fibrosis	PMID:17507829
Asthma	PMID:16629790
Interstitial lung disease	PMID:11445799
Interstitial lung disease	PMID:18263595
Chronic obstructive pulmonary disease	PMID:15817713
Pulmonary fibrosis	PMID:13680361
lung squamous cell carcinoma	PMID:16570259
Lung disease	PMID:8569184
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray