• Gene id: 64388

Gene Summary

• Gene Symbol: GREM2   Gene   UCSC   Ensembl
• Aliases: CKTSF1B2, DAND3, PRDC, STHAG9
• Gene name: gremlin 2, DAN family BMP antagonist
• Alternate names: gremlin-2, DAN domain family member 3, cysteine knot superfamily 1, BMP antagonist 2, gremlin 2, cysteine knot superfamily, homolog, protein related to DAN and cerberus,
• Gene location: 1q43 (240612371: 240489572)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene bel
• OMIM: 608832

Protein Summary

• Protein general information: Q9H772  
  • Name: Gremlin 2 (Cysteine knot superfamily 1, BMP antagonist 2) (DAN domain family member 3) (Protein related to DAN and cerberus)
  • Length: 168  
  • Mass: 19320
• Sequence:

  MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKT
  QPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQ
  KVKQCRCMSVNLSDSDKQ

• Structural information:
  • Protein Domains: (73..16-)
    (/note="CTCK-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00039"-)
  • Interpro: IPR006207  IPR029034  IPR004133  IPR017159  
  • Prosite: PS01225
  • STRING: ENSP00000318650
• Other Databases: GeneCards:  GREM2  Malacards:  GREM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048018	receptor ligand activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0036122	BMP binding	IBA	molecular function
GO:0038098	sequestering of BMP from receptor via BMP binding	IBA	biological process
GO:0060300	regulation of cytokine activity	ISS	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0010172	embryonic body morphogenesis	ISS	biological process
GO:0008201	heparin binding	ISS	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0030509	BMP signaling pathway	TAS	biological process
GO:0060300	regulation of cytokine activity	IEA	biological process
GO:0038098	sequestering of BMP from receptor via BMP binding	IEA	biological process
GO:0036122	BMP binding	IEA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0010172	embryonic body morphogenesis	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0048263	determination of dorsal identity	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Tooth agenesis	KEGG:H00625
Tooth agenesis	KEGG:H00625
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq