• Gene id: 64377

Gene Summary

• Gene Symbol: CHST8   Gene   UCSC   Ensembl
• Aliases: GALNAC4ST1, GalNAc4ST, PSS3
• Gene name: carbohydrate sulfotransferase 8
• Alternate names: carbohydrate sulfotransferase 8, GALNAC-4-ST1, GalNAc-4-O-sulfotransferase 1, N-acetylgalactosamine-4-O-sulfotransferase 1, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8, galNAc4ST-1,
• Gene location: 19q13.11 (33621952: 33773508)     Exons: 9     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylg
• OMIM: 609920

Protein Summary

• Protein general information: Q9H2A9  
  • Name: Carbohydrate sulfotransferase 8 (EC 2.8.2. ) (GalNAc 4 O sulfotransferase 1) (GalNAc 4 ST1) (GalNAc4ST 1) (N acetylgalactosamine 4 O sulfotransferase 1)
  • Length: 424  
  • Mass: 48834
  • Tissue specificity: Predominantly expressed in pituitary gland. In brain, it is expressed in pituitary gland, cerebellum, medulla oblongata, pons, thalamus and spinal cord. Expressed in the epidermis. Expressed at lower level in lung, spleen, adrenal glan
• Sequence:

  MTLRPGTMRLACMFSSILLFGAAGLLLFISLQDPTELAPQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERV
  TRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMPAAATIPANSSDAPFIRPGPGTLDGRWVSLH
  RSQQERKRVMQEACAKYRASSSRRAVTPRHVSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQHN
  TVHYGSALKRLDTFDRQGILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREAL
  RTGSGVRFPEFVQYLLDVHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFLSLIRAPRNLTFPRFKD
  RHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDYLMFNYSKPFADLY

• Structural information:
  • Interpro: IPR018011  IPR005331  
  • STRING: ENSP00000262622
• Other Databases: GeneCards:  CHST8  Malacards:  CHST8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0030166	proteoglycan biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016051	carbohydrate biosynthetic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030166	proteoglycan biosynthetic process	IDA	biological process
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0007417	central nervous system development	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0042446	hormone biosynthetic process	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Peeling skin syndrome	KEGG:H00737
Peeling skin syndrome	KEGG:H00737
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq