• Gene id: 643664

Gene Summary

• Gene Symbol: SLC35G6   Gene   UCSC   Ensembl
• Aliases: AMAC1L3, TMEM21B
• Gene name: solute carrier family 35 member G6
• Alternate names: solute carrier family 35 member G6, acyl-malonyl condensing enzyme 1-like 3, acyl-malonyl-condensing enzyme 1-like protein 3, protein AMAC1L3, transmembrane protein 21B,
• Gene location: 17p13.1 (7481401: 7483063)     Exons: 2     NC_000017.11

Protein Summary

• Protein general information: P0C7Q6  
  • Name: Solute carrier family 35 member G6 (Acyl malonyl condensing enzyme 1 like protein 3) (Transmembrane protein 21B)
  • Length: 338  
  • Mass: 35103
  • Tissue specificity: Expressed in placenta and testis. {ECO
• Sequence:

  MAGSHPYLNPPDSTHPSPPSAPPSLRWHQCCQPSDATNGLLVALLGGGLPAGFVGPLSHMAYQASNLPSLELLIC
  RCLFHLPIALLLKLRGDPLLGPPDIRGRAYFYALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLE
  SQGLSGYDWCGLLGSILGLIIIVGPGLWTLQEGITGVYTALGYGQAFVGGLALSLGLLVYRSLHFPSCLPTVAFL
  SGLVGLLGSVPGLFVLQPPVLPSDLPSWSCVGAVGILALVSFTCVSYAVTKAHPALVCAVLHSEVVVALILQYYM
  LHETVAPSDIVGAGVVLGSIAIITAWNLSCEREGKVEE

• Structural information:
  • Protein Domains: (49..17-)
    (/note="EamA-1)
    (272..32-)
    (/note="EamA-2")
  • STRING: ENSP00000396523
• Other Databases: GeneCards:  SLC35G6  Malacards:  SLC35G6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq