• Gene id: 64359

Gene Summary

• Gene Symbol: NXN   Gene   UCSC   Ensembl
• Aliases: NRX, RRS2, TRG-4
• Gene name: nucleoredoxin
• Alternate names: nucleoredoxin, nucleoredoxin 1,
• Gene location: 17p13.3 (979775: 799309)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the thioredoxin superfamily, a group of small, multifunctional redox-active proteins. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation an
• OMIM: 612895

Protein Summary

• Protein general information: Q6DKJ4  
  • Name: Nucleoredoxin (EC 1.8.1.8)
  • Length: 435  
  • Mass: 48392
• Sequence:

  MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAG
  AAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDATTGKVVCRNG
  LLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEA
  GQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDE
  DCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGE
  DDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI

• Structural information:
  • Protein Domains: (167..32-)
    (/note="Thioredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691"-)
  • Interpro: IPR041861  IPR012336  IPR036249  IPR013766  
  • Prosite: PS51352
  • CDD: cd03071
  • STRING: ENSP00000337443
• Other Databases: GeneCards:  NXN  Malacards:  NXN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031397	negative regulation of protein ubiquitination	ISS	biological process
GO:0016055	Wnt signaling pathway	IMP	biological process
GO:0072358	cardiovascular system development	ISS	biological process
GO:0030178	negative regulation of Wnt signaling pathway	ISS	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0047134	protein-disulfide reductase activity	IEA	molecular function
GO:0072358	cardiovascular system development	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0004791	thioredoxin-disulfide reductase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq