• Gene id: 6434

Gene Summary

• Gene Symbol: TRA2B   Gene   UCSC   Ensembl
• Aliases: Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
• Gene name: transformer 2 beta homolog
• Alternate names: transformer-2 protein homolog beta, TRA-2 beta, protein phosphatase 1, regulatory subunit 156, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), transformer-2 protein homolog B,
• Gene location: 3q27.2 (185938026: 185914557)     Exons: 10     NC_000003.12
• Gene summary(Entrez): This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided
• OMIM: 602719

Protein Summary

• Protein general information: P62995  
  • Name: Transformer 2 protein homolog beta (TRA 2 beta) (TRA2 beta) (hTRA2 beta) (Splicing factor, arginine/serine rich 10) (Transformer 2 protein homolog B)
  • Length: 288  
  • Mass: 33666
  • Tissue specificity: Highest expression in heart, skeletal muscle and pancreas. Less abundant in kidney, placenta and brain. Lowest expression in kidney and liver. {ECO
• Sequence:

  MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTRSRSRS
  RSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIV
  YDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRG
  YDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY

• Structural information:
  • Protein Domains: (118..19-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 2CQC 2KXN 2RRA 2RRB
  • PDBsum: 2CQC 2KXN 2RRA 2RRB
  • DIP: 42278
  • STRING: ENSP00000416959
• Other Databases: GeneCards:  TRA2B  Malacards:  TRA2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005681	spliceosomal complex	IBA	cellular component
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IBA	biological process
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0000302	response to reactive oxygen species	IEA	biological process
GO:1990403	embryonic brain development	IEA	biological process
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IEA	biological process
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0021796	cerebral cortex regionalization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005681	spliceosomal complex	IMP	cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0071333	cellular response to glucose stimulus	IMP	biological process
GO:0036002	pre-mRNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000375	RNA splicing, via transesterification reactions	TAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0003723	RNA binding	IMP	molecular function
GO:0043484	regulation of RNA splicing	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Macular degeneration	PMID:24098751
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881