• Gene id: 6430

Gene Summary

• Gene Symbol: SRSF5   Gene   UCSC   Ensembl
• Aliases: HRS, SFRS5, SRP40
• Gene name: serine and arginine rich splicing factor 5
• Alternate names: serine/arginine-rich splicing factor 5, SR splicing factor 5, delayed-early protein HRS, pre-mRNA-splicing factor SRP40, splicing factor, arginine/serine-rich 5,
• Gene location: 14q24.1 (69767111: 69772004)     Exons: 9     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for
• OMIM: 602383

Protein Summary

• Protein general information: Q13243  
  • Name: Serine/arginine rich splicing factor 5 (Delayed early protein HRS) (Pre mRNA splicing factor SRP40) (Splicing factor, arginine/serine rich 5)
  • Length: 272  
  • Mass: 31264
• Sequence:

  MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARAR
  SRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVE
  FASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRS
  KSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN

• Structural information:
  • Protein Domains: (4..7-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (108..18-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR035585  IPR000504  
  • Prosite: PS50102
  • CDD: cd12337
  • DIP: 46894
  • STRING: ENSP00000452123
• Other Databases: GeneCards:  SRSF5  Malacards:  SRSF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016607	nuclear speck	IBA	cellular component
GO:0045292	mRNA cis splicing, via spliceosome	IBA	biological process
GO:0016607	nuclear speck	ISS	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	TAS	biological process
GO:0006376	mRNA splice site selection	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0043422	protein kinase B binding	IEA	molecular function
GO:0033120	positive regulation of RNA splicing	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0097421	liver regeneration	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa03040	Spliceosome

Diseases

Associated diseases	References
Breast cancer	PMID:17651715
colon adenocarcinoma	PMID:9865741
clear cell renal cell carcinoma	PMID:21082031
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray