• Gene id: 643

Gene Summary

• Gene Symbol: CXCR5   Gene   UCSC   Ensembl
• Aliases: BLR1, CD185, MDR15
• Gene name: C-X-C motif chemokine receptor 5
• Alternate names: C-X-C chemokine receptor type 5, Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5), Burkitt lymphoma receptor 1, GTP-binding protein, CXC-R5, CXCR-5, MDR-15, chemokine (C-X-C motif) receptor 5, monocyte-derived receptor 15,
• Gene location: 11q23.3 (118883891: 118897786)     Exons: 2     NC_000011.10
• Gene summary(Entrez): This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migr
• OMIM: 601613

SNPs

rs6103330

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.43458814T>A
NC_000020.11   g.43458814T>C
NC_000020.11   g.43458814T>G
NC_000020.10   g.42087454T>A
NC_000020.10   g.42087454T>C
NC_000020.10   g.42087454T>G
NG_029906.1   g.5951T>A
NG_029906.1   g.5951T>C
NG_029906.1   g.5951T>G|SEQ=[T/A/C/G]|GENE=SRS

rs2059807

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.7166098A>G
NC_000019.10   g.7166098A>T
NC_000019.9   g.7166109A>G
NC_000019.9   g.7166109A>T
NG_008852.2   g.132903T>C
NG_008852.2   g.132903T>A|SEQ=[A/G/T]|GENE=INSR

Protein Summary

• Protein general information: P32302  
  • Name: C X C chemokine receptor type 5 (CXC R5) (CXCR 5) (Burkitt lymphoma receptor 1) (Monocyte derived receptor 15) (MDR 15) (CD antigen CD185)
  • Length: 372  
  • Mass: 41955
  • Tissue specificity: Expression in mature B-cells and Burkitt lymphoma cells.
• Sequence:

  MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFLLGVIGNVLVLVI
  LERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLLACIAVDRYLA
  IVHAVHAYRHRRLLSIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVA
  GFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL
  PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF

• Structural information:
  • Interpro: IPR001053  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5834
  • STRING: ENSP00000292174
• Other Databases: GeneCards:  CXCR5  Malacards:  CXCR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0042113	B cell activation	IEA	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0042113	B cell activation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048535	lymph node development	IEA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq