• Gene id: 64282

Gene Summary

• Gene Symbol: TENT4B   Gene   UCSC   Ensembl
• Aliases: PAPD5, TRF4-2, TUT3
• Gene name: terminal nucleotidyltransferase 4B
• Alternate names: terminal nucleotidyltransferase 4B, PAP associated domain containing 5, PAP-associated domain-containing protein 5, TUTase 3, non-canonical poly(A) RNA polymerase PAPD5, poly(A) RNA polymerase D5, non-canonical, terminal guanylyltransferase, terminal nucleotidyl,
• Gene location: 16q12.1 (50152910: 50235309)     Exons: 13     NC_000016.10
• OMIM: 605540

Protein Summary

• Protein general information: Q8NDF8  
  • Name: Terminal nucleotidyltransferase 4B (Non canonical poly(A) RNA polymerase PAPD5) (EC 2.7.7.19) (PAP associated domain containing protein 5) (Terminal guanylyltransferase) (EC 2.7.7. ) (Terminal uridylyltransferase 3) (TUTase 3) (Topoisomerase related funct
  • Length: 572  
  • Mass: 63267
• Sequence:

  MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPADSASGS
  SNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIES
  VIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDS
  FTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPRE
  DACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSY
  GAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGPVSSSS
  ATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSS
  KGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR

• Structural information:
  • Protein Domains: (308..36-)
    (/note="PAP-associated"-)
  • Interpro: IPR002058  IPR002934  IPR040136  
  • DIP: 59183
  • STRING: ENSP00000396995
• Other Databases: GeneCards:  TENT4B  Malacards:  TENT4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071044	histone mRNA catabolic process	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0071050	snoRNA polyadenylation	IBA	biological process
GO:0031499	TRAMP complex	IBA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IBA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0010587	miRNA catabolic process	IDA	biological process
GO:0043629	ncRNA polyadenylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IDA	molecular function
GO:0006378	mRNA polyadenylation	IDA	biological process
GO:0031499	TRAMP complex	IDA	cellular component
GO:0071050	snoRNA polyadenylation	IDA	biological process
GO:0070568	guanylyltransferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033500	carbohydrate homeostasis	IMP	biological process
GO:1905870	positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	biological process
GO:0060212	negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IMP	biological process
GO:0071076	RNA 3' uridylation	IMP	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0043631	RNA polyadenylation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0003887	DNA-directed DNA polymerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0070034	telomerase RNA binding	IC	molecular function
GO:0043630	ncRNA polyadenylation involved in polyadenylation-dependent ncRNA catabolic process	IMP	biological process
GO:0032211	negative regulation of telomere maintenance via telomerase	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0071044	histone mRNA catabolic process	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq