• Gene id: 6425

Gene Summary

• Gene Symbol: SFRP5   Gene   UCSC   Ensembl
• Aliases: SARP3
• Gene name: secreted frizzled related protein 5
• Alternate names: secreted frizzled-related protein 5, FRP-1b, SARP-3, frizzled-related protein 1b, sFRP-5, secreted apoptosis related protein 3,
• Gene location: 10q24.2 (97771998: 97766750)     Exons: 3     NC_000010.11
• Gene summary(Entrez): Secreted frizzled-related protein 5 (SFRP5) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP5 and SFRP1 may be invo
• OMIM: 302910

Protein Summary

• Protein general information: Q5T4F7  
  • Name: Secreted frizzled related protein 5 (sFRP 5) (Frizzled related protein 1b) (FRP 1b) (Secreted apoptosis related protein 3) (SARP 3)
  • Length: 317  
  • Mass: 35563
  • Tissue specificity: Highly expressed in the retinal pigment epithelium (RPE) and pancreas. Weak expression in heart, liver and muscle. {ECO
• Sequence:

  MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPN
  LLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEML
  HCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQK
  KKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
  YPCSLYYPFFYGAAEPH

• Structural information:
  • Protein Domains: (48..16-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090-)
    (181..30-)
    (/note="NTR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00295"-)
  • Interpro: IPR015526  IPR020067  IPR036790  IPR001134  IPR018933   IPR034860  IPR041761  IPR008993  
  • Prosite: PS50038 PS50189
  • CDD: cd07444
  • STRING: ENSP00000266066
• Other Databases: GeneCards:  SFRP5  Malacards:  SFRP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	NAS	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030510	regulation of BMP signaling pathway	IEA	biological process
GO:0030111	regulation of Wnt signaling pathway	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007601	visual perception	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:2000057	negative regulation of Wnt signaling pathway involved in digestive tract morphogenesis	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray