• Gene id: 6424

Gene Summary

• Gene Symbol: SFRP4   Gene   UCSC   Ensembl
• Aliases: FRP-4, FRPHE, FRZB-2, PYL, sFRP-4
• Gene name: secreted frizzled related protein 4
• Alternate names: secreted frizzled-related protein 4, frizzled protein, human endometrium, secreted frizzled-related protein 4; secreted frizzled-related protein 4,
• Gene location: 7p14.1 (37916816: 37905931)     Exons: 6     NC_000007.14
• Gene summary(Entrez): Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in
• OMIM: 608753

Protein Summary

• Protein general information: Q6FHJ7  
  • Name: Secreted frizzled related protein 4 (sFRP 4) (Frizzled protein, human endometrium) (FrpHE)
  • Length: 346  
  • Mass: 39827
  • Tissue specificity: Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In
• Sequence:

  MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRF
  FLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDV
  KWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFK
  SSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
  KKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

• Structural information:
  • Protein Domains: (19..13-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090-)
    (178..30-)
    (/note="NTR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00295"-)
  • Interpro: IPR015526  IPR020067  IPR036790  IPR001134  IPR018933   IPR026560  IPR008993  
  • Prosite: PS50038 PS50189
  • STRING: ENSP00000410715
• Other Databases: GeneCards:  SFRP4  Malacards:  SFRP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	NAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:2000051	negative regulation of non-canonical Wnt signaling pathway	ISS	biological process
GO:0030510	regulation of BMP signaling pathway	ISS	biological process
GO:0060349	bone morphogenesis	IMP	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0017147	Wnt-protein binding	IDA	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030510	regulation of BMP signaling pathway	IEA	biological process
GO:2000051	negative regulation of non-canonical Wnt signaling pathway	IEA	biological process
GO:0060349	bone morphogenesis	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045606	positive regulation of epidermal cell differentiation	IDA	biological process
GO:2000119	negative regulation of sodium-dependent phosphate transport	IDA	biological process
GO:2000119	negative regulation of sodium-dependent phosphate transport	IDA	biological process
GO:0002092	positive regulation of receptor internalization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0055062	phosphate ion homeostasis	IDA	biological process
GO:0055062	phosphate ion homeostasis	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:1902174	positive regulation of keratinocyte apoptotic process	IDA	biological process
GO:0009725	response to hormone	NAS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R