• Gene id: 64232

Gene Summary

• Gene Symbol: MS4A5   Gene   UCSC   Ensembl
• Aliases: CD20-L2, CD20L2, TETM4
• Gene name: membrane spanning 4-domains A5
• Alternate names: membrane-spanning 4-domains subfamily A member 5, CD20 antigen-like 2, testis-expressed transmembrane protein 4, testis-expressed transmembrane-4 protein,
• Gene location: 11q12.2 (60429571: 60447791)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic
• OMIM: 606499

Protein Summary

• Protein general information: Q9H3V2  
  • Name: Membrane spanning 4 domains subfamily A member 5 (CD20 antigen like 2) (Testis expressed transmembrane protein 4)
  • Length: 200  
  • Mass: 22283
  • Tissue specificity: Expressed at high level in the testis. Detected also in the pancreas, heart and in the brain.
• Sequence:

  MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIMTFSFGVIFLFTLLKP
  YPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIMNFLSALGAIAGIILLTFGFILDQNYICGYS
  HQNSQCKAVTVLFLGILITLMTFSIIELFISLPFSILGCHSEDCDCEQCC

• Structural information:
  • Interpro: IPR007237  IPR030417  IPR030426  
  • STRING: ENSP00000300190
• Other Databases: GeneCards:  MS4A5  Malacards:  MS4A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray