• Gene id: 64231

Gene Summary

• Gene Symbol: MS4A6A   Gene   UCSC   Ensembl
• Aliases: 4SPAN3, 4SPAN3.2, CD20L3, CDA01, MS4A6, MST090, MSTP090
• Gene name: membrane spanning 4-domains A6A
• Alternate names: membrane-spanning 4-domains subfamily A member 6A, CD20 antigen-like 3, CD20-like precusor, HAIRB-iso, MS4A6A-polymorph, four-span transmembrane protein 3, four-span transmembrane protein 3.1, four-span transmembrane protein 3.2, membrane-spanning 4-domains, subf,
• Gene location: 11q12.2 (60184665: 60171606)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic
• OMIM: 603302

Protein Summary

• Protein general information: Q9H2W1  
  • Name: Membrane spanning 4 domains subfamily A member 6A (CD20 antigen like 3) (Four span transmembrane protein 3)
  • Length: 248  
  • Mass: 26943
  • Tissue specificity: Variable expression in some B-cell, myelomonocytic, and erythroleukemia cell lines.
• Sequence:

  MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNF
  TQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCE
  LDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGTLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHS
  YIGNSGMSSKMTHDCGYEELLTS

• Structural information:
  • Interpro: IPR007237  IPR030417  
  • STRING: ENSP00000392770
• Other Databases: GeneCards:  MS4A6A  Malacards:  MS4A6A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R