• Gene id: 6423

Gene Summary

• Gene Symbol: SFRP2   Gene   UCSC   Ensembl
• Aliases: FRP-2, SARP1, SDF-5
• Gene name: secreted frizzled related protein 2
• Alternate names: secreted frizzled-related protein 2, SARP-1, sFRP-2, secreted apoptosis related protein 1, testicular tissue protein Li 170,
• Gene location: 4q31.3 (153789082: 153780590)     Exons: 3     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the p
• OMIM: 608192

Protein Summary

• Protein general information: Q96HF1  
  • Name: Secreted frizzled related protein 2 (FRP 2) (sFRP 2) (Secreted apoptosis related protein 1) (SARP 1)
  • Length: 295  
  • Mass: 33490
  • Tissue specificity: Expressed in adipose tissue, heart, brain, skeletal muscle, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in adipose tissue, small intestine and colon. {ECO
• Sequence:

  MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQ
  AGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDND
  LCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLN
  GVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

• Structural information:
  • Protein Domains: (35..15-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090-)
    (172..29-)
    (/note="NTR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00295"-)
  • Interpro: IPR015526  IPR020067  IPR036790  IPR001134  IPR018933   IPR026558  IPR041764  IPR008993  
  • Prosite: PS50038 PS50189
  • CDD: cd07446
  • STRING: ENSP00000274063
• Other Databases: GeneCards:  SFRP2  Malacards:  SFRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	NAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IDA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0090244	Wnt signaling pathway involved in somitogenesis	IEA	biological process
GO:0071481	cellular response to X-ray	IEA	biological process
GO:0071425	hematopoietic stem cell proliferation	IEA	biological process
GO:0061185	negative regulation of dermatome development	IEA	biological process
GO:0061133	endopeptidase activator activity	IEA	molecular function
GO:0061056	sclerotome development	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0043508	negative regulation of JUN kinase activity	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0031668	cellular response to extracellular stimulus	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0021915	neural tube development	IEA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0010950	positive regulation of endopeptidase activity	IEA	biological process
GO:0010667	negative regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0002063	chondrocyte development	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:2000041	negative regulation of planar cell polarity pathway involved in axis elongation	IEA	biological process
GO:2000035	regulation of stem cell division	IEA	biological process
GO:1904956	regulation of midbrain dopaminergic neuron differentiation	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090179	planar cell polarity pathway involved in neural tube closure	IEA	biological process
GO:0090175	regulation of establishment of planar polarity	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060349	bone morphogenesis	IEA	biological process
GO:0060028	convergent extension involved in axis elongation	IEA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0048546	digestive tract morphogenesis	IEA	biological process
GO:0048018	receptor ligand activity	IEA	molecular function
GO:0046546	development of primary male sexual characteristics	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0042733	embryonic digit morphogenesis	IEA	biological process
GO:0042662	negative regulation of mesodermal cell fate specification	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0030199	collagen fibril organization	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0030111	regulation of Wnt signaling pathway	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0001968	fibronectin binding	ISS	molecular function
GO:0005178	integrin binding	ISS	molecular function
GO:0048018	receptor ligand activity	ISS	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0007267	cell-cell signaling	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0062023	collagen-containing extracellular matrix	ISS	cellular component
GO:0033630	positive regulation of cell adhesion mediated by integrin	ISS	biological process
GO:0061056	sclerotome development	ISS	biological process
GO:0061185	negative regulation of dermatome development	ISS	biological process
GO:0001569	branching involved in blood vessel morphogenesis	ISS	biological process
GO:0003151	outflow tract morphogenesis	IMP	biological process
GO:0003214	cardiac left ventricle morphogenesis	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0045766	positive regulation of angiogenesis	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0050680	negative regulation of epithelial cell proliferation	IDA	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0030307	positive regulation of cell growth	ISS	biological process
GO:2000035	regulation of stem cell division	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0071425	hematopoietic stem cell proliferation	ISS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray