• Gene id: 642273

Gene Summary

• Gene Symbol: FAM110C   Gene   UCSC   Ensembl
• Gene name: family with sequence similarity 110 member C
• Alternate names: protein FAM110C,
• Gene location: 2p25.3 (47076: 38813)     Exons: 6     NC_000002.12
• OMIM: 300008

Protein Summary

• Protein general information: Q1W6H9  
  • Name: Protein FAM110C
  • Length: 321  
  • Mass: 33863
  • Tissue specificity: Detected in stomach, thyroid, trachea, adrenal gland and testis, and at low levels in prostate, ovary, intestine, colon, spinal cord and lymph node. {ECO
• Sequence:

  MRALAALSAPPNERLLPRDPAATRDPDAARPARRSAVERLAADRAKYVRGRPGTGRGVASEGSGPGAIKCPGNDP
  GPPARAPAPVARRAIARKPLRPDSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPE
  TVPTTPGPAADPAIPETPAPAARSAAPSSVPAAPPGPEPRVVRRRGLQRSQSDLSSRYSAALAESDTFFQYCGLD
  PEVVEALGRENFTAGSDCVTLKVRSVSVATSGSGFSRHSGGDDEGLQEEELIEQVPSTTSVIERNARIIKWLYTC
  KKAKETPSQEQSRTRGSKPSR

• Structural information:
  • Interpro: IPR025740  IPR025741  IPR025739  
  • STRING: ENSP00000328347
• Other Databases: GeneCards:  FAM110C  Malacards:  FAM110C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005938	cell cortex	IBA	cellular component
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0060491	regulation of cell projection assembly	IBA	biological process
GO:0043014	alpha-tubulin binding	IBA	molecular function
GO:0005938	cell cortex	IDA	cellular component
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0060491	regulation of cell projection assembly	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R