• Gene id: 64224

Gene Summary

• Gene Symbol: HERPUD2   Gene   UCSC   Ensembl
• Gene name: HERPUD family member 2
• Alternate names: homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein, homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2,
• Gene location: 7p14.2 (35695810: 35632658)     Exons: 9     NC_000007.14
• OMIM: 608461

Protein Summary

• Protein general information: Q9BSE4  
  • Name: Homocysteine responsive endoplasmic reticulum resident ubiquitin like domain member 2 protein
  • Length: 406  
  • Mass: 45147
• Sequence:

  MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRK
  QDEYHMVHLVCTSRTPPSSPKSSTNRESHEALASSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQ
  TDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTT
  SQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFS
  RFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDGLEDESGEDGGEDASA
  IQRPGLMASAWSFITTFFTSLIPEGPPQVAN

• Structural information:
  • Protein Domains: (10..8-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR039751  IPR000626  IPR029071  
  • Prosite: PS50053
  • PDB: 2KDB
  • PDBsum: 2KDB
  • STRING: ENSP00000379390
• Other Databases: GeneCards:  HERPUD2  Malacards:  HERPUD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030968	endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray