• Gene id: 64223

Gene Summary

• Gene Symbol: MLST8   Gene   UCSC   Ensembl
• Aliases: GBL, GbetaL, LST8, POP3, WAT1
• Gene name: MTOR associated protein, LST8 homolog
• Alternate names: target of rapamycin complex subunit LST8, TORC subunit LST8, gable, mammalian lethal with SEC13 protein 8, protein GbetaL,
• Gene location: 16p13.3 (2204627: 2209452)     Exons: 11     NC_000016.10

Protein Summary

• Protein general information: Q9BVC4  
  • Name: Target of rapamycin complex subunit LST8 (TORC subunit LST8) (G protein beta subunit like) (Gable) (Protein GbetaL) (Mammalian lethal with SEC13 protein 8) (mLST8)
  • Length: 326  
  • Mass: 35876
  • Tissue specificity: Broadly expressed, with highest levels in skeletal muscle, heart and kidney. {ECO
• Sequence:

  MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNP
  NPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSG
  AIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQ
  CRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
  TGEIKREYGGHQKAVVCLAFNDSVLG

• Structural information:
  • Interpro: IPR020472  IPR037588  IPR011047  IPR015943  IPR001680   IPR019775  IPR017986  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 4JSN 4JSP 4JSV 4JSX 4JT5 4JT6 5FLC 5H64 5WBU 5WBY 5ZCS 6BCU 6BCX 6SB0 6SB2
  • PDBsum: 4JSN 4JSP 4JSV 4JSX 4JT5 4JT6 5FLC 5H64 5WBU 5WBY 5ZCS 6BCU 6BCX 6SB0 6SB2
  • DIP: 39481
  • STRING: ENSP00000456405
• Other Databases: GeneCards:  MLST8  Malacards:  MLST8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031931	TORC1 complex	IBA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0031932	TORC2 complex	IBA	cellular component
GO:0031929	TOR signaling	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031931	TORC1 complex	IEA	cellular component
GO:0031929	TOR signaling	IEA	biological process
GO:0031932	TORC2 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0032148	activation of protein kinase B activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0031931	TORC1 complex	IDA	cellular component
GO:0038202	TORC1 signaling	IMP	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0031931	TORC1 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04714	Thermogenesis
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq