• Gene id: 64180

Gene Summary

• Gene Symbol: DPEP3   Gene   UCSC   Ensembl
• Aliases: MBD3
• Gene name: dipeptidase 3
• Alternate names: dipeptidase 3, membrane-bound dipeptidase 3, metallopeptidase (family M19), testis secretory sperm-binding protein Li 211a,
• Gene location: 16q22.1 (151734745: 151745563)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene encodes a membrane-bound glycoprotein from the family of dipeptidases involved in hydrolytic metabolism of various dipeptides, including penem and carbapenem beta-lactam antibiotics. This gene is located on chromosome 16 in a cluster with anothe
• OMIM: 609926

Protein Summary

• Protein general information: Q9H4B8  
  • Name: Dipeptidase 3 (EC 3.4.13.19)
  • Length: 488  
  • Mass: 53687
• Sequence:

  MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTP
  KTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQD
  QTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTC
  STPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNL
  LNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVST
  YPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLE
  VTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC

• Structural information:
  • Interpro: IPR000180  IPR028531  IPR032466  IPR008257  
  • Prosite: PS00869 PS51365
  • CDD: cd01301
  • STRING: ENSP00000268793
• Other Databases: GeneCards:  DPEP3  Malacards:  DPEP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	ISS	cellular component
GO:0001669	acrosomal vesicle	ISS	cellular component
GO:0031225	anchored component of membrane	ISS	cellular component
GO:0016805	dipeptidase activity	ISS	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008239	dipeptidyl-peptidase activity	IEA	molecular function
GO:0008235	metalloexopeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 23869807
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray