• Gene id: 6418

Gene Summary

• Gene Symbol: SET   Gene   UCSC   Ensembl
• Aliases: 2PP2A, I2PP2A, IGAAD, IPP2A2, MRD58, PHAPII, TAF-I, TAF-IBETA
• Gene name: SET nuclear proto-oncogene
• Alternate names: protein SET, HLA-DR-associated protein II, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), Template-Activating Factor-I, chromatin remodelling factor, chromatin remodelling factor, inhibitor of granzyme A-activated DNase, inhibitor-2 of pr,
• Gene location: 9q34.11 (128683423: 128696395)     Exons: 13     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-d
• OMIM: 616396

Protein Summary

• Protein general information: Q01105  
  • Name: Protein SET (HLA DR associated protein II) (Inhibitor of granzyme A activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I 2PP2A) (Template activating factor I) (TAF I)
  • Length: 290  
  • Mass: 33489
  • Tissue specificity: Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.
• Sequence:

  MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNK
  LRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENK
  VLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDI
  WPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • PDB: 2000 0000 0000 0000 1525 9539 6821 8377 4006 5899 2994 1893 120
  • PDBsum: 2000 0000 0000 0000 1525 9539 6821 8377 4006 5899 2994 1893 120
  • DIP: 33561
  • STRING: ENSP00000361777
• Other Databases: GeneCards:  SET  Malacards:  SET

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	TAS	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	TAS	molecular function
GO:0006260	DNA replication	TAS	biological process
GO:0006334	nucleosome assembly	TAS	biological process
GO:0043524	negative regulation of neuron apoptotic process	IGI	biological process
GO:0043524	negative regulation of neuron apoptotic process	IGI	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035067	negative regulation of histone acetylation	TAS	biological process
GO:0006337	nucleosome disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042393	histone binding	TAS	molecular function
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881