• Gene id: 64174

Gene Summary

• Gene Symbol: DPEP2   Gene   UCSC   Ensembl
• Aliases: MBD2
• Gene name: dipeptidase 2
• Alternate names: dipeptidase 2,
• Gene location: 16q22.1 (68000643: 67987389)     Exons: 13     NC_000016.10
• Gene summary(Entrez): DPEP2 belongs to the membrane-bound dipeptidase (EC 3.4.13.19) family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione de
• OMIM: 252800

Protein Summary

• Protein general information: Q9H4A9  
  • Name: Dipeptidase 2 (EC 3.4.13.19)
  • Length: 486  
  • Mass: 53365
• Sequence:

  MQPSGLEGPGTFGRWPLLSLLLLLLLLQPVTCAYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQGLQEQ
  ARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQTQDRDALRLTL
  EQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESS
  AKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDIL
  QLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEEL
  LSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPI
  HWTAKLPAKWSVSESSPHMAPVLAVVATFPVLILWL

• Structural information:
  • Interpro: IPR000180  IPR028531  IPR032466  IPR008257  
  • Prosite: PS00869 PS51365
  • CDD: cd01301
  • STRING: ENSP00000458977
• Other Databases: GeneCards:  DPEP2  Malacards:  DPEP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006691	leukotriene metabolic process	ISS	biological process
GO:0016805	dipeptidase activity	ISS	molecular function
GO:0031225	anchored component of membrane	ISS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008239	dipeptidyl-peptidase activity	IEA	molecular function
GO:0008235	metalloexopeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq