• Gene id: 64151

Gene Summary

• Gene Symbol: NCAPG   Gene   UCSC   Ensembl
• Aliases: CAPG, CHCG, NY-MEL-3, YCG1
• Gene name: non-SMC condensin I complex subunit G
• Alternate names: condensin complex subunit 3, XCAP-G homolog, chromosome condensation protein G, chromosome-associated protein G, condensin subunit CAP-G, melanoma antigen NY-MEL-3,
• Gene location: 4p15.31 (157180839: 157255184)     Exons: 18     NC_000005.10
• Gene summary(Entrez): This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for
• OMIM: 606280

Protein Summary

• Protein general information: Q9BPX3  
  • Name: Condensin complex subunit 3 (Chromosome associated protein G) (Condensin subunit CAP G) (hCAP G) (Melanoma antigen NY MEL 3) (Non SMC condensin I complex subunit G) (XCAP G homolog)
  • Length: 1015  
  • Mass: 114334
  • Tissue specificity: Highly expressed in testis. {ECO
• Sequence:

  MGAERRLLSIKEAFRLAQQPHQNQAKLVVALSRTYRTMDDKTVFHEEFIHYLKYVMVVYKREPAVERVIEFAAKF
  VTSFHQSDMEDDEEEEDGGLLNYLFTFLLKSHEANSNAVRFRVCLLINKLLGSMPENAQIDDDVFDKINKAMLIR
  LKDKIPNVRIQAVLALSRLQDPKDDECPVVNAYATLIENDSNPEVRRAVLSCIAPSAKTLPKIVGRTKDVKEAVR
  KLAYQVLAEKVHMRAMSIAQRVMLLQQGLNDRSDAVKQAMQKHLLQGWLRFSEGNILELLHRLDVENSSEVAVSV
  LNALFSITPLSELVGLCKNNDGRKLIPVETLTPEIALYWCALCEYLKSKGDEGEEFLEQILPEPVVYADYLLSYI
  QSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDTSEEGGRKKLLAVLQEILILPTIPISLVSFLVERLLH
  IIIDDNKRTQIVTEIISEIRAPIVTVGVNNDPADVRKKELKMAEIKVKLIEAKEALENCITLQDFNRASELKEEI
  KALEDARINLLKETEQLEIKEVHIEKNDAETLQKCLILCYELLKQMSISTGLSATMNGIIESLILPGIISIHPVV
  RNLAVLCLGCCGLQNQDFARKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGIEPFKTKKIKTLHCEGTEINSD
  DEQESKEVEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLILLWYNPVTEEDVQLRH
  CLGVFFPVFAYASRTNQECFEEAFLPTLQTLANAPASSPLAEIDITNVAELLVDLTRPSGLNPQAKTSQDYQALT
  VHDNLAMKICNEILTSPCSPEIRVYTKALSSLELSSHLAKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGNKE
  FGDQAEAAQDATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSES
  DHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR027165  IPR025977  
  • PDB: 6IGX
  • PDBsum: 6IGX
  • DIP: 34891
  • STRING: ENSP00000251496
• Other Databases: GeneCards:  NCAPG  Malacards:  NCAPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007076	mitotic chromosome condensation	IBA	biological process
GO:0000793	condensed chromosome	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0000796	condensin complex	IEA	cellular component
GO:0007076	mitotic chromosome condensation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000796	condensin complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000793	condensed chromosome	IEA	cellular component
GO:0000779	condensed chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007076	mitotic chromosome condensation	IDA	biological process
GO:0000796	condensin complex	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007076	mitotic chromosome condensation	NAS	biological process
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray