• Gene id: 6415

Gene Summary

• Gene Symbol: SELENOW   Gene   UCSC   Ensembl
• Aliases: SEPW1, selW
• Gene name: selenoprotein W
• Alternate names: selenoprotein W, selenoprotein W, 1,
• Gene location: 19q13.33 (47778702: 47784681)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a selenoprotein containing a selenocysteine (Sec) residue, which is encoded by the UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion seq
• OMIM: 603235

Protein Summary

• Protein general information: P63302  
  • Name: Selenoprotein W (SelW)
  • Length: 87  
  • Mass: 9448
  • Tissue specificity: Ubiquitously expressed with highest levels in skeletal muscle and heart, moderate levels in brain, spinal cord, thyroid, spleen, prostate, ovary, small intestine and colon, and lowest levels in liver and lymph node. {ECO
• Sequence:

  MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLK
  LVAAIKAALAQG

• Structural information:
  • Interpro: IPR011893  IPR036249  
  • STRING: ENSP00000473185
• Other Databases: GeneCards:  SELENOW  Malacards:  SELENOW

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010269	response to selenium ion	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016209	antioxidant activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq