• Gene id: 64149

Gene Summary

• Gene Symbol: C17orf75   Gene   UCSC   Ensembl
• Aliases: NJMU-R1, SRI2
• Gene name: chromosome 17 open reading frame 75
• Alternate names: protein Njmu-R1, sensitization to ricin complex subunit 2, spermatogenesis-related protein,
• Gene location: 17q11.2 (32350048: 32328440)     Exons: 12     NC_000017.11
• OMIM: 0

Protein Summary

• Protein general information: Q9HAS0  
  • Name: Protein Njmu R1
  • Length: 396  
  • Mass: 44622
  • Tissue specificity: Highly expressed in testis and also expressed in fetal testis.
• Sequence:

  MLPSLQESMDGDEKELESSEEGGSAEERRLEPPSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSL
  SLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTIDSERNPSEY
  VVCFLGGSEKGLELFRLELDKYIQGLKNNMNCEARGLESHIKSYLSSWFEDVVCPIQRVVLLFQEKLTFLLHAAL
  SYTPVEVKESDEKTKRDINRFLSVASLQGLIHEGTMTSLCMAMTEEQHKSVVIDCSSSQPQFCNAGSNRFCEDWM
  QAFLNGAKGGNPFLFRQVLENFKLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHEEMP
  EAKNVIAVLEEFMKEALDQSF

• Structural information:
  • Interpro: IPR028280  
  • STRING: ENSP00000464275
• Other Databases: GeneCards:  C17orf75  Malacards:  C17orf75

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0099041	vesicle tethering to Golgi	IBA	biological process
GO:0099041	vesicle tethering to Golgi	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0006886	intracellular protein transport	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)