• Gene id: 6414

Gene Summary

• Gene Symbol: SELENOP   Gene   UCSC   Ensembl
• Aliases: SELP, SEPP, SEPP1, SeP
• Gene name: selenoprotein P
• Alternate names: selenoprotein P, selenoprotein P, plasma, 1,
• Gene location: 5p12 (42812075: 42799879)     Exons: 7     NC_000005.10
• Gene summary(Entrez): This gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (10 in human), and accounts for most of th
• OMIM: 601484

SNPs

rs4680

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.19963748G>A
NC_000022.10   g.19951271G>A
NG_011526.1   g.27009G>A
NM_000754.4   c.472G>A
NM_000754.3   c.472G>A
NM_007310.3   c.322G>A
NM_007310.2   c.322G>A
NM_001362828.2   c.472G>A
NM_001362828.1   c.472G>A
NM_001135161.2   c.472G>A
NM_001135161.1   c.

Protein Summary

• Protein general information: P49908  
  • Name: Selenoprotein P (SeP)
  • Length: 381  
  • Mass: 43174
  • Tissue specificity: Made in the liver and heart and secreted into the plasma. It is also found in the kidney.
• Sequence:

  MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLEDLRVK
  LKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLP
  FSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSE
  NQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSU
  CCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIPTEASASURUKNQAKK
  UEUPSN

• Structural information:
  • Interpro: IPR007671  IPR007672  IPR037941  
  • STRING: ENSP00000420939
• Other Databases: GeneCards:  SELENOP  Malacards:  SELENOP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001887	selenium compound metabolic process	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0008430	selenium binding	IBA	molecular function
GO:0008430	selenium binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008430	selenium binding	TAS	molecular function
GO:0006979	response to oxidative stress	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019953	sexual reproduction	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001887	selenium compound metabolic process	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0008430	selenium binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)