• Gene id: 64130

Gene Summary

• Gene Symbol: LIN7B   Gene   UCSC   Ensembl
• Aliases: LIN-7B, MALS-2, MALS2, VELI2
• Gene name: lin-7 homolog B, crumbs cell polarity complex component
• Alternate names: protein lin-7 homolog B, hLin7B, hVeli2, mammalian lin-seven protein 2, veli-2, vertebrate lin-7 homolog 2,
• Gene location: 19q13.33 (49114338: 49118463)     Exons: 6     NC_000019.10
• OMIM: 604240

Protein Summary

• Protein general information: Q9HAP6  
  • Name: Protein lin 7 homolog B (Lin 7B) (hLin7B) (Mammalian lin seven protein 2) (MALS 2) (Vertebrate lin 7 homolog 2) (Veli 2) (hVeli2)
  • Length: 207  
  • Mass: 22896
• Sequence:

  MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATA
  KATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEG
  EQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLESRG

• Structural information:
  • Protein Domains: (10..6-)
    (/note="L27-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (93..17-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR014775  IPR004172  IPR036892  IPR017365  IPR001478   IPR036034  
  • Prosite: PS51022 PS50106
  • PDB: 2DKR
  • PDBsum: 2DKR
  • STRING: ENSP00000221459
• Other Databases: GeneCards:  LIN7B  Malacards:  LIN7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097016	L27 domain binding	IBA	molecular function
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0007269	neurotransmitter secretion	IBA	biological process
GO:0005911	cell-cell junction	IBA	cellular component
GO:1903361	protein localization to basolateral plasma membrane	IBA	biological process
GO:0097025	MPP7-DLG1-LIN7 complex	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0045199	maintenance of epithelial cell apical/basal polarity	IBA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray