• Gene id: 64129

Gene Summary

• Gene Symbol: TINAGL1   Gene   UCSC   Ensembl
• Aliases: ARG1, LCN7, LIECG3, TINAGRP
• Gene name: tubulointerstitial nephritis antigen like 1
• Alternate names: tubulointerstitial nephritis antigen-like, OLRG-2, P3ECSL, TIN Ag-related protein, TIN-Ag-RP, TINAG-like 1, androgen-regulated gene 1, glucocorticoid-inducible protein 5, lipocalin 7, oxidized-LDL responsive gene 2, tubulointerstitial nephritis antigen-related prot,
• Gene location: 1p35.2 (31576383: 31587685)     Exons: 13     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is similar in sequence to tubulointerstitial nephritis antigen, a secreted glycoprotein that is recognized by antibodies in some types of immune-related tubulointerstitial nephritis. Three transcript variants encoding diff
• OMIM: 603905

Protein Summary

• Protein general information: Q9GZM7  
  • Name: Tubulointerstitial nephritis antigen like (Glucocorticoid inducible protein 5) (Oxidized LDL responsive gene 2 protein) (OLRG 2) (Tubulointerstitial nephritis antigen related protein) (TIN Ag related protein) (TIN Ag RP)
  • Length: 467  
  • Mass: 52387
  • Tissue specificity: Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, smal
• Sequence:

  MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAICYCDL
  FCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPCLVDPDMIKAI
  NQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLIHEPLDQGN
  CAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRER
  DEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFL
  YKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIES
  FVLGVWGRVGMEDMGHH

• Structural information:
  • Protein Domains: (50..9-)
    (/note="SMB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00350"-)
  • Interpro: IPR038765  IPR025660  IPR000668  IPR001212  
  • Prosite: PS00524 PS50958 PS00639
  • STRING: ENSP00000271064
• Other Databases: GeneCards:  TINAGL1  Malacards:  TINAGL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IDA	NOT|molecular function
GO:0006508	proteolysis	IDA	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043236	laminin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016197	endosomal transport	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005201	extracellular matrix structural constituent	NAS	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IDA	NOT|molecular function
GO:0006508	proteolysis	IDA	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043236	laminin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016197	endosomal transport	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005201	extracellular matrix structural constituent	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray