• Gene id: 64123

Gene Summary

• Gene Symbol: ADGRL4   Gene   UCSC   Ensembl
• Aliases: ELTD1, ETL, KPG_003
• Gene name: adhesion G protein-coupled receptor L4
• Alternate names: adhesion G protein-coupled receptor L4, EGF, latrophilin and seven transmembrane domain containing 1, EGF, latrophilin and seven transmembrane domain-containing protein 1, EGF-TM7-latrophilin-related protein,
• Gene location: 1p31.1 (79006729: 78889763)     Exons: 15     NC_000001.11

Protein Summary

• Protein general information: Q9HBW9  
  • Name: Adhesion G protein coupled receptor L4 (EGF, latrophilin and seven transmembrane domain containing protein 1) (EGF TM7 latrophilin related protein) (ETL protein)
  • Length: 690  
  • Mass: 77811
  • Tissue specificity: Detected in the majority of epithelial cells in tumor and normal tissues. Expressed also in human umbilical vein endothelial cells. {ECO
• Sequence:

  MKRLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDNECGNLTQSCGENANC
  TNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNS
  VTDLSPTDIITYIEILAESSSLLGYKNNTISAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKL
  MHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFV
  YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHRKVTDRYRSLCAFWNY
  SPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIGIKDYNILTRITQLGIIISLICLAICIFTFW
  FFSEIQSTRTTIHKNLCCSLFLAELVFLVGINTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYN
  KGFLHKNFYIFGYLSPAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
  AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFIFLFLCVLSRKIQEEY
  YRLFKNVPCCFGCLR

• Structural information:
  • Protein Domains: (20..5-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (58..10-)
    (/note="EGF-like-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (367..41-)
    (/note="GPS-)
    (/evidence="ECO:0000255|PROSITE--)
  • Interpro: IPR001881  IPR013032  IPR000742  IPR000152  IPR018097   IPR032471  IPR017981  IPR000832  IPR017983  IPR000203  
  • Prosite: PS00010 PS00018 PS01186 PS50026 PS01187 PS00650 PS50261 PS50221
  • STRING: ENSP00000359778
• Other Databases: GeneCards:  ADGRL4  Malacards:  ADGRL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0065003	protein-containing complex assembly	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
hypertrophic cardiomyopathy	PMID:22606234
Glioblastoma multiforme	PMID:23096411
Asthenoozoospermia	MIK: 32167074

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
32167074	Asthenoozoospermia			12 (6controls, 6 cases)	Male infertility	Microarray