• Gene id: 64122

Gene Summary

• Gene Symbol: FN3K   Gene   UCSC   Ensembl
• Gene name: fructosamine 3 kinase
• Alternate names: fructosamine-3-kinase, protein-psicosamine 3-kinase FN3K, protein-ribulosamine 3-kinase FN3K,
• Gene location: 17q25.3 (82735614: 82751195)     Exons: 7     NC_000017.11
• Gene summary(Entrez): A high concentration of glucose can result in non-enzymatic oxidation of proteins by reaction of glucose and lysine residues (glycation). Proteins modified in this way, fructosamines, are less active or functional. This gene encodes an enzyme which cataly

Protein Summary

• Protein general information: Q9H479  
  • Name: Fructosamine 3 kinase (EC 2.7.1.171) (Protein psicosamine 3 kinase FN3K) (Protein ribulosamine 3 kinase FN3K) (EC 2.7.1.172)
  • Length: 309  
  • Mass: 35171
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLEALRSTGLVRVPRPMK
  VIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREKLKEEENTVGRRGEGAEPQYVDKFGFHTVTC
  CGFIPQVNEWQDDWPTFFARHRLQAQLDLIEKDYADREARELWSRLQVKIPDLFCGLEIVPALLHGDLWSGNVAE
  DDVGPIIYDPASFYGHSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPS
  LGTMRRLLK

• Structural information:
  • Interpro: IPR016477  IPR011009  
  • STRING: ENSP00000300784
• Other Databases: GeneCards:  FN3K  Malacards:  FN3K

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0030387	fructosamine-3-kinase activity	IBA	molecular function
GO:0030389	fructosamine metabolic process	IBA	biological process
GO:0030387	fructosamine-3-kinase activity	IDA	molecular function
GO:0030387	fructosamine-3-kinase activity	IDA	molecular function
GO:0030387	fructosamine-3-kinase activity	IDA	molecular function
GO:0036525	protein deglycation	IDA	biological process
GO:0036525	protein deglycation	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0102193	protein-ribulosamine 3-kinase activity	IEA	molecular function
GO:0102194	protein-fructosamine 3-kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0043687	post-translational protein modification	TAS	biological process
GO:0036525	protein deglycation	IEA	biological process
GO:0030389	fructosamine metabolic process	IEA	biological process
GO:0030387	fructosamine-3-kinase activity	IEA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0030387	fructosamine-3-kinase activity	NAS	molecular function
GO:0030393	fructoselysine metabolic process	NAS	biological process
GO:0016301	kinase activity	IBA	molecular function
GO:0030387	fructosamine-3-kinase activity	IBA	molecular function
GO:0030389	fructosamine metabolic process	IBA	biological process
GO:0030387	fructosamine-3-kinase activity	IDA	molecular function
GO:0030387	fructosamine-3-kinase activity	IDA	molecular function
GO:0030387	fructosamine-3-kinase activity	IDA	molecular function
GO:0036525	protein deglycation	IDA	biological process
GO:0036525	protein deglycation	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0102193	protein-ribulosamine 3-kinase activity	IEA	molecular function
GO:0102194	protein-fructosamine 3-kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0043687	post-translational protein modification	TAS	biological process
GO:0036525	protein deglycation	IEA	biological process
GO:0030389	fructosamine metabolic process	IEA	biological process
GO:0030387	fructosamine-3-kinase activity	IEA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0030387	fructosamine-3-kinase activity	NAS	molecular function
GO:0030393	fructoselysine metabolic process	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R