• Gene id: 64116

Gene Summary

• Gene Symbol: SLC39A8   Gene   UCSC   Ensembl
• Aliases: BIGM103, CDG2N, LZT-Hs6, PP3105, ZIP8
• Gene name: solute carrier family 39 member 8
• Alternate names: metal cation symporter ZIP8, zinc transporter ZIP8, BCG induced integral membrane protein BIGM103, BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, ZIP-8, Zrt- and Irt-like protein 8, solute carrier ,
• Gene location: 4q24 (102345481: 102251040)     Exons: 6     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
• OMIM: 608732

Protein Summary

• Protein general information: Q9C0K1  
  • Name: Metal cation symporter ZIP8 (BCG induced integral membrane protein in monocyte clone 103 protein) (LIV 1 subfamily of ZIP zinc transporter 6) (LZT Hs6) (Solute carrier family 39 member 8) (Zrt and Irt like protein 8) (ZIP 8)
  • Length: 460  
  • Mass: 49631
  • Tissue specificity: Ubiquitously expressed (PubMed
• Sequence:

  MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCL
  TAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILT
  PLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQ
  NGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI
  GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACS
  CYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLREKVTGRKTDFTFFMIQNAGMLTGFTAILLI
  TLYAGEIELE

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000378310
• Other Databases: GeneCards:  SLC39A8  Malacards:  SLC39A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071578	zinc ion import across plasma membrane	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0071577	zinc ion transmembrane transport	IDA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0006882	cellular zinc ion homeostasis	IDA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0097079	selenite:proton symporter activity	IDA	molecular function
GO:0098711	iron ion import across plasma membrane	IDA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0097080	plasma membrane selenite transport	IDA	biological process
GO:0005381	iron ion transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0071421	manganese ion transmembrane transport	IMP	biological process
GO:0071421	manganese ion transmembrane transport	IMP	biological process
GO:0071578	zinc ion import across plasma membrane	IMP	biological process
GO:0006876	cellular cadmium ion homeostasis	IMP	biological process
GO:0015086	cadmium ion transmembrane transporter activity	IMP	molecular function
GO:0015296	anion:cation symporter activity	ISS	molecular function
GO:0030026	cellular manganese ion homeostasis	ISS	biological process
GO:0006525	arginine metabolic process	ISS	biological process
GO:0015087	cobalt ion transmembrane transporter activity	ISS	molecular function
GO:0071577	zinc ion transmembrane transport	IMP	biological process
GO:0071421	manganese ion transmembrane transport	IMP	biological process
GO:0005385	zinc ion transmembrane transporter activity	IMP	molecular function
GO:0005384	manganese ion transmembrane transporter activity	IMP	molecular function
GO:0005384	manganese ion transmembrane transporter activity	IMP	molecular function
GO:0030198	extracellular matrix organization	IMP	biological process
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0070574	cadmium ion transmembrane transport	IMP	biological process
GO:0015106	bicarbonate transmembrane transporter activity	ISS	molecular function
GO:1990079	cartilage homeostasis	ISS	biological process
GO:0061757	leukocyte adhesion to arterial endothelial cell	ISS	biological process
GO:0015701	bicarbonate transport	ISS	biological process
GO:0006824	cobalt ion transport	ISS	biological process
GO:0006487	protein N-linked glycosylation	ISS	biological process
GO:0042391	regulation of membrane potential	IMP	biological process
GO:0005384	manganese ion transmembrane transporter activity	IMP	molecular function
GO:1990540	mitochondrial manganese ion transmembrane transport	IMP	biological process
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070574	cadmium ion transmembrane transport	IEA	biological process
GO:0006824	cobalt ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005384	manganese ion transmembrane transporter activity	IEA	molecular function
GO:0005381	iron ion transmembrane transporter activity	IEA	molecular function
GO:1990079	cartilage homeostasis	IEA	biological process
GO:0097080	plasma membrane selenite transport	IEA	biological process
GO:0070574	cadmium ion transmembrane transport	IEA	biological process
GO:0061757	leukocyte adhesion to arterial endothelial cell	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0015701	bicarbonate transport	IEA	biological process
GO:0015106	bicarbonate transmembrane transporter activity	IEA	molecular function
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005384	manganese ion transmembrane transporter activity	IEA	molecular function
GO:0098711	iron ion import across plasma membrane	IEA	biological process
GO:0071578	zinc ion import across plasma membrane	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0015087	cobalt ion transmembrane transporter activity	IEA	molecular function
GO:0015086	cadmium ion transmembrane transporter activity	IEA	molecular function
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0140412	zinc:bicarbonate symporter activity	IEA	molecular function
GO:0098711	iron ion import across plasma membrane	IEA	biological process
GO:0071578	zinc ion import across plasma membrane	IEA	biological process
GO:0071577	zinc ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0030026	cellular manganese ion homeostasis	IEA	biological process
GO:0015296	anion:cation symporter activity	IEA	molecular function
GO:0015086	cadmium ion transmembrane transporter activity	IEA	molecular function
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0006525	arginine metabolic process	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0015698	inorganic anion transport	IEA	biological process
GO:0015698	inorganic anion transport	IEA	biological process
GO:0031090	organelle membrane	IDA	cellular component
GO:0006829	zinc ion transport	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04216	Ferroptosis

Diseases

Associated diseases	References
Congenital disorders of glycosylation type II	KEGG:H00119
Congenital disorders of glycosylation type II	KEGG:H00119
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R