• Gene id: 64115

Gene Summary

• Gene Symbol: VSIR   Gene   UCSC   Ensembl
• Aliases: B7-H5, B7H5, C10orf54, DD1alpha, Dies1, GI24, PD-1H, PP2135, SISP1, VISTA
• Gene name: V-set immunoregulatory receptor
• Alternate names: V-type immunoglobulin domain-containing suppressor of T-cell activation, Death Domain1alpha, PDCD1 homolog, V-domain Ig suppressor of T cell activation, V-set domain-containing immunoregulatory receptor, platelet receptor GI24, sisp-1, stress-induced secreted pr,
• Gene location: 10q22.1 (71773519: 71747555)     Exons: 7     NC_000010.11
• OMIM: 608523

Protein Summary

• Protein general information: Q9H7M9  
  • Name: V type immunoglobulin domain containing suppressor of T cell activation (Platelet receptor Gi24) (Stress induced secreted protein 1) (Sisp 1) (V set domain containing immunoregulatory receptor) (V set immunoregulatory receptor)
  • Length: 311  
  • Mass: 33908
  • Tissue specificity: Expressed in spleen. Detected on a number of myeloid cells including CD11b monocytes, CD66b+ neutrophils, at low levels on CD4+ and CD8+ T-cells, and in a subset of NK cells. Not detected on B cells (at protein level). Expressed at hig
• Sequence:

  MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRS
  SRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVE
  IRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNR
  RAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLD
  PVPDSPNFEVI

• Structural information:
  • Protein Domains: (33..16-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR042473  
  • Prosite: PS50835
  • PDB: 6MVL 6OIL 6U6V
  • PDBsum: 6MVL 6OIL 6U6V
  • DIP: 57562
  • STRING: ENSP00000378409
• Other Databases: GeneCards:  VSIR  Malacards:  VSIR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050776	regulation of immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0061133	endopeptidase activator activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0032693	negative regulation of interleukin-10 production	IDA	biological process
GO:0032689	negative regulation of interferon-gamma production	IDA	biological process
GO:0010950	positive regulation of endopeptidase activity	IDA	biological process
GO:0120158	positive regulation of collagen catabolic process	IDA	biological process
GO:0032700	negative regulation of interleukin-17 production	IDA	biological process
GO:0031638	zymogen activation	IDA	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:2000565	negative regulation of CD8-positive, alpha-beta T cell proliferation	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R