• Gene id: 64112

Gene Summary

• Gene Symbol: MOAP1   Gene   UCSC   Ensembl
• Aliases: MAP-1, PNMA4
• Gene name: modulator of apoptosis 1
• Alternate names: modulator of apoptosis 1, MAP1, paraneoplastic Ma antigen family member 4, paraneoplastic antigen Ma4, paraneoplastic antigen like 4,
• Gene location: 14q32.12 (93184896: 93182198)     Exons: 3     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been show

Protein Summary

• Protein general information: Q96BY2  
  • Name: Modulator of apoptosis 1 (MAP 1) (MAP1) (Paraneoplastic antigen Ma4)
  • Length: 351  
  • Mass: 39513
  • Tissue specificity: Widely expressed, with high levels in heart and brain. {ECO
• Sequence:

  MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLTAETSH
  ALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQAL
  EALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESLRGPALDVIRVLKINN
  PLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIA
  GAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNFT

• Structural information:
  • Interpro: IPR026523  
  • DIP: 49959
  • STRING: ENSP00000451594
• Other Databases: GeneCards:  MOAP1  Malacards:  MOAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	IMP	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R