• Gene id: 64110

Gene Summary

• Gene Symbol: MAGEF1   Gene   UCSC   Ensembl
• Aliases: MAGE-F1
• Gene name: MAGE family member F1
• Alternate names: melanoma-associated antigen F1, MAGE-F1 antigen, melanoma antigen family F, 1, melanoma antigen family F1,
• Gene location: 3q27.1 (184712063: 184710363)     Exons: 1     NC_000003.12
• Gene summary(Entrez): This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. [provided by RefSeq, Jul 2008]
• OMIM: 609267

Protein Summary

• Protein general information: Q9HAY2  
  • Name: Melanoma associated antigen F1 (MAGE F1) (MAGE F1 antigen)
  • Length: 307  
  • Mass: 35222
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARRRAYRR
  LNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLK
  PLEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLS
  YRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASA
  RAGIHLW

• Structural information:
  • Protein Domains: (76..27-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR041898  IPR041899  IPR002190  
  • Prosite: PS50838
  • STRING: ENSP00000315064
• Other Databases: GeneCards:  MAGEF1  Malacards:  MAGEF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097428	protein maturation by iron-sulfur cluster transfer	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:2000042	negative regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)