• Gene id: 64105

Gene Summary

• Gene Symbol: CENPK   Gene   UCSC   Ensembl
• Aliases: AF5alpha, CENP-K, FKSG14, P33, Solt
• Gene name: centromere protein K
• Alternate names: centromere protein K, SoxLZ/Sox6-binding protein Solt, interphase centromere complex protein 37, leucine zipper protein FKSG14, protein AF-5alpha,
• Gene location: 5q12.3 (65563193: 65488918)     Exons: 19     NC_000005.10
• Gene summary(Entrez): CENPK is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[sup
• OMIM: 605758

Protein Summary

• Protein general information: Q9BS16  
  • Name: Centromere protein K (CENP K) (Interphase centromere complex protein 37) (Protein AF 5alpha) (p33)
  • Length: 269  
  • Mass: 31655
  • Tissue specificity: Detected in several fetal organs with highest levels in fetal liver. In adults, it is weakly expressed in lung and placenta. {ECO
• Sequence:

  MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAELSQWQ
  KKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKV
  ETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLFD
  VPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ

• Structural information:
  • Interpro: IPR020993  
  • STRING: ENSP00000379911
• Other Databases: GeneCards:  CENPK  Malacards:  CENPK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0051382	kinetochore assembly	IEA	biological process
GO:0000941	condensed nuclear chromosome inner kinetochore	IBA	cellular component
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray