• Gene id: 64101

Gene Summary

• Gene Symbol: LRRC4   Gene   UCSC   Ensembl
• Aliases: NAG14, NGL-2
• Gene name: leucine rich repeat containing 4
• Alternate names: leucine-rich repeat-containing protein 4, brain tumor associated protein LRRC4, brain tumor-associated protein BAG, nasopharyngeal carcinoma-associated gene 14 protein, netrin-G2 ligand,
• Gene location: 7q32.1 (128032106: 128027070)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene is significantly downregulated in primary brain tumors. The exact function of the protein encoded by this gene is unknown. [provided by RefSeq, Jul 2008]
• OMIM: 605417

Protein Summary

• Protein general information: Q9HBW1  
  • Name: Leucine rich repeat containing protein 4 (Brain tumor associated protein BAG) (Nasopharyngeal carcinoma associated gene 14 protein) (Netrin G2 ligand) (NGL 2)
  • Length: 653  
  • Mass: 72717
  • Tissue specificity: Specifically expressed in brain. {ECO
• Sequence:

  MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPS
  NTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLR
  ELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEM
  SGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHN
  PWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCR
  TPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSN
  YSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKT
  TKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPT
  IHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI

• Structural information:
  • Protein Domains: (39..7-)
    (/note="LRRNT-)
    (300..35-)
    (/note="LRRCT-)
    (353..44-)
    (/note="Ig-like"-)
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  IPR026882  IPR000372  
  • Prosite: PS50835 PS51450
  • PDB: 2DL9 3ZYI
  • PDBsum: 2DL9 3ZYI
  • STRING: ENSP00000249363
• Other Databases: GeneCards:  LRRC4  Malacards:  LRRC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030054	cell junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0097119	postsynaptic density protein 95 clustering	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:1904861	excitatory synapse assembly	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0060076	excitatory synapse	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0044309	neuron spine	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray