• Gene id: 64094

Gene Summary

• Gene Symbol: SMOC2   Gene   UCSC   Ensembl
• Aliases: DTDP1, MST117, MSTP117, MSTP140, SMAP2, bA270C4A.1, bA37D8.1, dJ421D16.1
• Gene name: SPARC related modular calcium binding 2
• Alternate names: SPARC-related modular calcium-binding protein 2, SMAP-2, SMOC-2, secreted modular calcium-binding protein 2, smooth muscle associated protein 2, thyroglobulin type-1 repeat containing protein,
• Gene location: 6q27 (168441152: 168667991)     Exons: 14     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the SPARC family (secreted protein acidic and rich in cysteine/osteonectin/BM-40), which are highly expressed during embryogenesis and wound healing. The gene product is a matricellular protein which promotes matrix assembly
• OMIM: 131222

Protein Summary

• Protein general information: Q9H3U7  
  • Name: SPARC related modular calcium binding protein 2 (Secreted modular calcium binding protein 2) (SMOC 2) (Smooth muscle associated protein 2) (SMAP 2)
  • Length: 446  
  • Mass: 49674
• Sequence:

  MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQ
  LEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKT
  PRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALE
  EAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQ
  LQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIKPF
  KRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRHTPRGHAESTSNRQPRKQG

• Structural information:
  • Protein Domains: (34..8-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (87..15-)
    1 (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500-)
    (213..28-)
    2 (/note="Thyroglobulin-type-1)
    (/evidence="ECO:00-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR002350  IPR036058   IPR037640  IPR019577  IPR000716  IPR036857  
  • Prosite: PS00018 PS50222 PS51465 PS00484 PS51162
  • CDD: cd16241 cd00191
  • STRING: ENSP00000346537
• Other Databases: GeneCards:  SMOC2  Malacards:  SMOC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0005614	interstitial matrix	IEA	cellular component
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0035470	positive regulation of vascular wound healing	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IDA	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:1900748	positive regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0045743	positive regulation of fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0005509	calcium ion binding	ISA	molecular function
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IGI	biological process
GO:2001028	positive regulation of endothelial cell chemotaxis	IGI	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IGI	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IGI	biological process

Diseases

Associated diseases	References
Dentin dysplasia	KEGG:H02348
Dentin dysplasia	KEGG:H02348
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray