• Gene id: 64090

Gene Summary

• Gene Symbol: GAL3ST2   Gene   UCSC   Ensembl
• Aliases: GAL3ST-2, GP3ST
• Gene name: galactose-3-O-sulfotransferase 2
• Alternate names: galactose-3-O-sulfotransferase 2, beta-galactose-3-O-sulfotransferase 2, gal 3-O-sulphotransferase, gal-beta-1, 3-GalNAc 3'-sulfotransferase 2, galbeta1-3GalNAc 3'-sulfotransferase 2, glycoprotein beta-Gal 3'-sulfotransferase 2,
• Gene location: 2q37.3 (241776821: 241804286)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate group to the hydroxyl at C-3 of nonreducing beta-galactosyl residues, and it can act on both type 1 a
• OMIM: 615608

Protein Summary

• Protein general information: Q9H3Q3  
  • Name: Galactose 3 O sulfotransferase 2 (Gal3ST 2) (EC 2.8.2. ) (Beta galactose 3 O sulfotransferase 2) (Gal beta 1, 3 GalNAc 3' sulfotransferase 2) (Glycoprotein beta Gal 3' sulfotransferase 2)
  • Length: 398  
  • Mass: 46110
  • Tissue specificity: Ubiquitous. Detected in heart, stomach, colon, liver and spleen, in epithelial cells lining the lower to middle layer of the crypts in colonic mucosa, hepatocytes surrounding the central vein of the liver, extravillous cytotrophoblasts
• Sequence:

  MMSMLGGLQRYFRVILLLLLALTLLLLAGFLHSDLELDTPLFGGQAEGPPVTNIMFLKTHKTASSTVLNILYRFA
  ETHNLSVALPAGSRVHLGYPWLFLARYVEGVGSQQRFNIMCNHLRFNLPQVQKVMPNDTFYFSILRNPVFQLESS
  FIYYKTYAPAFRGAPSLDAFLASPRTFYNDSRHLRNVYAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVL
  IAEHLDESLVLLRRRLRWALDDVVAFRLNSRSARSVARLSPETRERARSWCALDWRLYEHFNRTLWAQLRAELGP
  RRLRGEVERLRARRRELASLCLQDGGALKNHTQIRDPRLRPYQSGKADILGYNLRPGLDNQTLGVCQRLVMPELQ
  YMARLYALQFPEKPLKNIPFLGA

• Structural information:
  • Interpro: IPR009729  IPR027417  
  • STRING: ENSP00000192314
• Other Databases: GeneCards:  GAL3ST2  Malacards:  GAL3ST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0009101	glycoprotein biosynthetic process	IBA	biological process
GO:0050694	galactose 3-O-sulfotransferase activity	IBA	molecular function
GO:0001733	galactosylceramide sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0009247	glycolipid biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq