• Gene id: 64089

Gene Summary

• Gene Symbol: SNX16   Gene   UCSC   Ensembl
• Gene name: sorting nexin 16
• Alternate names: sorting nexin-16,
• Gene location: 8q21.13 (81842325: 81799582)     Exons: 10     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The protein encoded by this gene associates with late end
• OMIM: 614903

Protein Summary

• Protein general information: P57768  
  • Name: Sorting nexin 16
  • Length: 344  
  • Mass: 39167
  • Tissue specificity: Detected in placenta, lung, liver,heart and pancreas. {ECO
• Sequence:

  MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRT
  KFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSR
  LNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEE
  SRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSA
  LEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED

• Structural information:
  • Protein Domains: (105..21-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR001683  IPR036871  IPR037911  
  • Prosite: PS50195
  • CDD: cd07276
  • PDB: 5GW0 5GW1
  • PDBsum: 5GW0 5GW1
  • STRING: ENSP00000379621
• Other Databases: GeneCards:  SNX16  Malacards:  SNX16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031313	extrinsic component of endosome membrane	IBA	cellular component
GO:0008333	endosome to lysosome transport	IBA	biological process
GO:0045022	early endosome to late endosome transport	IBA	biological process
GO:0035091	phosphatidylinositol binding	IBA	molecular function
GO:0006622	protein targeting to lysosome	IBA	biological process
GO:0005770	late endosome	IBA	cellular component
GO:0005769	early endosome	IBA	cellular component
GO:0031313	extrinsic component of endosome membrane	IDA	cellular component
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0005770	late endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0008333	endosome to lysosome transport	IMP	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0006622	protein targeting to lysosome	IMP	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)