• Gene id: 64078

Gene Summary

• Gene Symbol: SLC28A3   Gene   UCSC   Ensembl
• Aliases: CNT3
• Gene name: solute carrier family 28 member 3
• Alternate names: solute carrier family 28 member 3, concentrative Na(+)-nucleoside cotransporter 3, concentrative Na+-nucleoside cotransporter, solute carrier family 28 (concentrative nucleoside transporter), member 3, solute carrier family 28 (sodium-coupled nucleoside trans,
• Gene location: 9q21.32-q21.33 (84368726: 84273122)     Exons: 22     NC_000009.12
• Gene summary(Entrez): Nucleoside transporters, such as SLC28A3, regulate multiple cellular processes, including neurotransmission, vascular tone, adenosine concentration in the vicinity of cell surface receptors, and transport and metabolism of nucleoside drugs. SLC28A3 shows
• OMIM: 608488

Protein Summary

• Protein general information: Q9HAS3  
  • Name: Solute carrier family 28 member 3 (Concentrative Na(+) nucleoside cotransporter 3) (CNT 3) (hCNT3)
  • Length: 691  
  • Mass: 76930
  • Tissue specificity: Expressed in pancreas, bone marrow, trachea, mammary gland, liver, prostate, and regions of intestine, brain, lung, placenta, testis, kidney, and heart. {ECO
• Sequence:

  MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHMEDDDE
  EMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIFFVVWDHLMAK
  YEHRIDEMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVLLFLFSKYPTRVY
  WRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYKDHFFAFKVLPIVVFFSTVMS
  MLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSV
  LGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKMESGDSGNLLEAATQGASSSISLVANI
  AVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEH
  LSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYALCGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTV
  ACFMTACIAGILSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCT
  LLNPSTFNCNGISNTF

• Structural information:
  • Interpro: IPR008276  IPR018270  IPR030211  IPR011657  IPR002668   IPR011642  
  • STRING: ENSP00000365413
• Other Databases: GeneCards:  SLC28A3  Malacards:  SLC28A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901642	nucleoside transmembrane transport	IDA	biological process
GO:0015213	uridine transmembrane transporter activity	IDA	molecular function
GO:0005345	purine nucleobase transmembrane transporter activity	NAS	molecular function
GO:0015862	uridine transport	IDA	biological process
GO:0072531	pyrimidine-containing compound transmembrane transport	IDA	biological process
GO:1904823	purine nucleobase transmembrane transport	NAS	biological process
GO:0031526	brush border membrane	ISS	cellular component
GO:0005415	nucleoside:sodium symporter activity	IBA	molecular function
GO:0015389	pyrimidine- and adenine-specific:sodium symporter activity	IBA	molecular function
GO:0015860	purine nucleoside transmembrane transport	IBA	biological process
GO:1901642	nucleoside transmembrane transport	IBA	biological process
GO:0005337	nucleoside transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015293	symporter activity	IBA	molecular function
GO:0015390	purine-specific nucleoside:sodium symporter activity	IBA	molecular function
GO:0015864	pyrimidine nucleoside transport	IBA	biological process
GO:1901642	nucleoside transmembrane transport	IEA	biological process
GO:0005337	nucleoside transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005415	nucleoside:sodium symporter activity	TAS	molecular function
GO:0015860	purine nucleoside transmembrane transport	IEA	biological process
GO:0015389	pyrimidine- and adenine-specific:sodium symporter activity	IEA	molecular function
GO:0015864	pyrimidine nucleoside transport	IEA	biological process
GO:0015390	purine-specific nucleoside:sodium symporter activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0015855	pyrimidine nucleobase transport	IEA	biological process
GO:0015855	pyrimidine nucleobase transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq