• Gene id: 64077

Gene Summary

• Gene Symbol: LHPP   Gene   UCSC   Ensembl
• Aliases: HDHD2B
• Gene name: phospholysine phosphohistidine inorganic pyrophosphate phosphatase
• Alternate names: phospholysine phosphohistidine inorganic pyrophosphate phosphatase, hLHPP,
• Gene location: 10q26.13 (17810756: 17793445)     Exons: 5     NC_000004.12
• OMIM: 617231

Protein Summary

• Protein general information: Q9H008  
  • Name: Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (hLHPP) (EC 3.1.3. ) (EC 3.6.1.1)
  • Length: 270  
  • Mass: 29165
  • Tissue specificity: Expressed in brain, and at lower levels in liver and kidney. Detected in thyroid (at protein level). Expressed in liver, kidney and moderately in brain. {ECO
• Sequence:

  MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDI
  SEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVL
  ISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQR
  CGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

• Structural information:
  • Interpro: IPR036412  IPR006357  IPR023214  IPR006355  
  • CDD: cd07509
  • PDB: 2X4D
  • PDBsum: 2X4D
  • STRING: ENSP00000357835
• Other Databases: GeneCards:  LHPP  Malacards:  LHPP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0016311	dephosphorylation	IBA	biological process
GO:0101006	protein histidine phosphatase activity	IBA	molecular function
GO:0004427	inorganic diphosphatase activity	IBA	molecular function
GO:0016791	phosphatase activity	IBA	molecular function
GO:0006796	phosphate-containing compound metabolic process	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004427	inorganic diphosphatase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0101006	protein histidine phosphatase activity	ISS	molecular function
GO:0006470	protein dephosphorylation	ISS	biological process
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004427	inorganic diphosphatase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0009168	purine ribonucleoside monophosphate biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00190	Oxidative phosphorylation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq