About Us

Search Result


Gene id 64073
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol C19orf33   Gene   UCSC   Ensembl
Aliases H2RSP, IMUP, IMUP-1, IMUP-2
Gene name chromosome 19 open reading frame 33
Alternate names immortalization up-regulated protein, HAI-2 related small protein, hepatocyte growth factor activator inhibitor type 2-related small protein, immortalization-upregulated protein,
Gene location 19q13.2 (38304250: 38305005)     Exons: 4     NC_000019.10
Gene summary(Entrez) The protein encoded by this gene has been shown to be upregulated in SV40-immortalized fibroblasts as well as in endometrial carcinoma cells. The encoded protein is found primarily in the nucleus. This protein may play a role in placental development and
OMIM 609375

Protein Summary

Protein general information Q9GZP8  

Name: Immortalization up regulated protein (Hepatocyte growth factor activator inhibitor type 2 related small protein) (H2RSP) (HAI 2 related small protein)

Length: 106  Mass: 10897

Sequence MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSSSDSSSSSSDSDTDVKSHAAGSKQ
HESIPGKAKKPKVKKKEKGKKEKGKKKEAPH
Structural information
Interpro:  IPR026621  
STRING:   ENSP00000301246
Other Databases GeneCards:  C19orf33  Malacards:  C19orf33

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0008150 biological_process
ND biological process
GO:0005634 nucleus
IDA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005829 cytosol
IDA cellular component
Associated diseases References
Male factor infertility MIK: 29961538

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
29961538 Male facto
r infertil
ity

318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
Male infertility RNA-seq
Show abstract