• Gene id: 6407

Gene Summary

• Gene Symbol: SEMG2   Gene   UCSC   Ensembl
• Aliases: SGII
• Gene name: semenogelin 2
• Alternate names: semenogelin-2, semenogelin II,
• Gene location: 20q13.12 (45221368: 45224457)     Exons: 3     NC_000020.11
• Gene summary(Entrez): The secreted protein encoded by this gene is involved in the formation of a gel matrix that encases ejaculated spermatozoa. Proteolysis by the prostate-specific antigen (PSA) breaks down the gel matrix and allows the spermatozoa to move more freely. The e
• OMIM: 182141

Protein Summary

• Protein general information: Q02383  
  • Name: Semenogelin 2 (Semenogelin II) (SGII)
  • Length: 582  
  • Mass: 65,444
• Sequence:

  MKSIILFVLSLLLILEKQAAVMGQKGGSKGQLPSGSSQFPHGQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDIND
  HDWTRKSQQYDLNALHKATKSKQHLGGSQQLLNYKQEGRDHDKSKGHFHMIVIHHKGGQAHHGTQNPSQDQGNSP
  SGKGLSSQCSNTEKRLWVHGLSKEQASASGAQKGRTQGGSQSSYVLQTEELVVNKQQRETKNSHQNKGHYQNVVD
  VREEHSSKLQTSLHPAHQDRLQHGPKDIFTTQDELLVYNKNQHQTKNLSQDQEHGRKAHKISYPSSRTEERQLHH
  GEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQSSSTEERHLNCGEKGIQKGVSKGSIS
  IQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNSGEKDVQKGVSKGSISIQTEEKIHGKSQNQV
  TIPSQDQEHGHKENKMSYQSSSTEERRLNYGGKSTQKDVSQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKG
  KSGQSADSKQDLLSHEQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST

• Structural information:
  • Interpro: IPR008836  
  • STRING: ENSP00000361855
• Other Databases: GeneCards:  SEMG2  Malacards:  SEMG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002020	protease binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019731	antibacterial humoral response	IMP	biological process
GO:0046872	metal ion binding	IMP	molecular function
GO:0050817	coagulation	IDA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1900005	positive regulation of serine-type endopeptidase activity	IDA	biological process
GO:1901318	negative regulation of flagellated sperm motility	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019731	antibacterial humoral response	IMP	biological process
GO:0046872	metal ion binding	IMP	molecular function
GO:0050817	coagulation	IEA	biological process
GO:0050817	coagulation	IDA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1900005	positive regulation of serine-type endopeptidase activity	IDA	biological process
GO:1901318	negative regulation of flagellated sperm motility	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019731	antibacterial humoral response	IMP	biological process
GO:0046872	metal ion binding	IMP	molecular function
GO:0050817	coagulation	IDA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1900005	positive regulation of serine-type endopeptidase activity	IDA	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 21536282
Asthenozoospermia	MIK: 20720384
Asthenozoospermia	MIK: 20720384
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 21536282
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21536282	Male infertility				Male infertility	Semenogelin II precursor  clusterin isoform 1
20720384	Asthenozoospermia, Male infertility			46 (37 asthenozoospermic patients, 9 normal healthy subjects )	Male infertility	semenogelin I semenogelin II
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray