• Gene id: 64064

Gene Summary

• Gene Symbol: OXCT2   Gene   UCSC   Ensembl
• Aliases: FKSG25, SCOTT
• Gene name: 3-oxoacid CoA-transferase 2
• Alternate names: succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial, 3-oxoacid CoA-transferase 2A, testis-specific succinyl CoA:3-oxoacid CoA-transferase,
• Gene location: 1p34.2 (39771347: 39769522)     Exons: 1     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene catalyzes the transfer of a CoA group from succinate to acetoacetate and is an important enzyme in ketone body catabolism. The encoded protein localizes to the mitochondrion. This gene is intronless, and a pseudogene of th
• OMIM: 610289

Protein Summary

• Protein general information: Q9BYC2  
  • Name: Succinyl CoA:3 ketoacid coenzyme A transferase 2, mitochondrial (EC 2.8.3.5) (3 oxoacid CoA transferase 2A) (Testis specific succinyl CoA:3 oxoacid CoA transferase) (SCOT t)
  • Length: 517  
  • Mass: 56140
  • Tissue specificity: Testis specific. {ECO
• Sequence:

  MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVMIGGFGLCGIPENLIA
  ALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENTLCESQYLAGELELELTPQGTLAERIRAGGA
  GVPAFYTPTGYGTLVQEGGAPIRYTPDGHLALMSQPREVREFNGDHFLLERAIRADFALVKGWKADRAGNVVFRR
  SARNFNVPMCKAADVTAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTILKEEDGDAGKEEDART
  RIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTVLPGGC
  FFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGMGGAMDLVSSQKTRVVVTMQHCTKDNTPKIM
  EKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLRPMQQVAP

• Structural information:
  • Interpro: IPR012792  IPR012791  IPR014388  IPR004165  IPR004164   IPR004163  IPR037171  
  • Prosite: PS01273 PS01274
  • STRING: ENSP00000361914
• Other Databases: GeneCards:  OXCT2  Malacards:  OXCT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008410	CoA-transferase activity	IEA	molecular function
GO:0046952	ketone body catabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008260	3-oxoacid CoA-transferase activity	IEA	molecular function
GO:0031514	motile cilium	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0046952	ketone body catabolic process	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00280	Valine, leucine and isoleucine degradation
hsa00650	Butanoate metabolism
hsa00072	Synthesis and degradation of ketone bodies

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R