• Gene id: 64061

Gene Summary

• Gene Symbol: TSPYL2   Gene   UCSC   Ensembl
• Aliases: CDA1, CINAP, CTCL, DENTT, HRIHFB2216, NP79, SE204, TSPX
• Gene name: TSPY like 2
• Alternate names: testis-specific Y-encoded-like protein 2, CASK-interacting nucleosome assembly protein, CTCL tumor antigen se20-4, CTCL-associated antigen se20-4, TSPY-like protein 2, cell division autoantigen 1, cutaneous T-cell lymphoma-associated antigen se20-4, cutaneous T-,
• Gene location: Xp11.22 (53082366: 53088539)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle pr
• OMIM: 300564

Protein Summary

• Protein general information: Q9H2G4  
  • Name: Testis specific Y encoded like protein 2 (TSPY like protein 2) (Cell division autoantigen 1) (Cutaneous T cell lymphoma associated antigen se20 4) (CTCL associated antigen se20 4) (Differentially expressed nucleolar TGF beta1 target protein) (Nuclear prot
  • Length: 693  
  • Mass: 79435
  • Tissue specificity: Ubiquitously expressed, with highest levels in brain, testis and heart, and lowest levels in liver and pancreas. {ECO
• Sequence:

  MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLADMRGVGLGPALPPPPP
  YVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPTPEASGGSLEIDFQVVQSSSFGGEGALETCS
  AVGWAPQRLVDPKSKEEAIIIVEDEDEDERESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLD
  LEAVNIKAGKAFLRLKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR
  HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPE
  ADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDI
  KISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNT
  DDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD
  RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLED
  VLQVPNGWANPGKRGKTG

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • STRING: ENSP00000364591
• Other Databases: GeneCards:  TSPYL2  Malacards:  TSPYL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0008156	negative regulation of DNA replication	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0045859	regulation of protein kinase activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045786	negative regulation of cell cycle	NAS	biological process
GO:0009966	regulation of signal transduction	NAS	biological process
GO:0000182	rDNA binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881