• Gene id: 6406

Gene Summary

• Gene Symbol: SEMG1   Gene   UCSC   Ensembl
• Aliases: CT103, SEMG, SGI, dJ172H20.2
• Gene name: semenogelin 1
• Alternate names: semenogelin-1, SgI-29, cancer/testis antigen 103, semen coagulating protein, semenogelin I,
• Gene location: 20q13.12 (45206963: 45209772)     Exons: 3     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. This preproprotein is proteolytically processed by the prostate-specific a
• OMIM: 182140

Protein Summary

• Protein general information: P04279  
  • Name: Semenogelin 1 (Cancer/testis antigen 103) (Semenogelin I) (SGI) [Cleaved into: Alpha inhibin 92; Alpha inhibin 31; Seminal basic protein]
  • Length: 462  
  • Mass: 52,131
• Sequence:

  MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDAND
  HDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSP
  SGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVE
  VREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
  GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHYGENGVQKDVSQRSIY
  SQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLA
  QHLNNDRNPLFT

• Structural information:
  • Interpro: IPR008836  
  • STRING: ENSP00000361867
• Other Databases: GeneCards:  SEMG1  Malacards:  SEMG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007320	insemination	TAS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0046872	metal ion binding	IMP	molecular function
GO:0050817	coagulation	IDA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090281	negative regulation of calcium ion import	IDA	biological process
GO:1900005	positive regulation of serine-type endopeptidase activity	IMP	biological process
GO:1901318	negative regulation of flagellated sperm motility	IMP	biological process
GO:1901318	negative regulation of flagellated sperm motility	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007320	insemination	TAS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0046872	metal ion binding	IMP	molecular function
GO:0050817	coagulation	IEA	biological process
GO:0050817	coagulation	IDA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090281	negative regulation of calcium ion import	IDA	biological process
GO:1900005	positive regulation of serine-type endopeptidase activity	IMP	biological process
GO:1901318	negative regulation of flagellated sperm motility	IEA	biological process
GO:1901318	negative regulation of flagellated sperm motility	IMP	biological process
GO:1901318	negative regulation of flagellated sperm motility	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007320	insemination	TAS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0046872	metal ion binding	IMP	molecular function
GO:0050817	coagulation	IDA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090281	negative regulation of calcium ion import	IDA	biological process
GO:1900005	positive regulation of serine-type endopeptidase activity	IMP	biological process
GO:1901318	negative regulation of flagellated sperm motility	IMP	biological process
GO:1901318	negative regulation of flagellated sperm motility	IDA	biological process

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 23289976
Sperm motility	MIK: 12632094
Male factor infertility	MIK: 24680362
Asthenozoospermia	MIK: 23289976
Male infertility	MIK: 20720384
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24680362	Male infertility			49 (24 infertile couples with moderate or high seminal viscosity, 25 consecutive infertile couples with normal semen viscosity)	Male infertility
25355644	Male infertility				Male infertility	SEMG1 PIP GAPDHS PGK2
23289976	Asthenozoospermia			24 (12 asthenozoosperm patients, 12 age-matched volunteers)	Male infertility
12632094	Male infertility, sperm motility, asthenozoospermia				Male infertility	Sg-I
20720384	Asthenozoospermia, Male infertility			46 (37 asthenozoospermic patients, 9 normal healthy subjects )	Male infertility	semenogelin I semenogelin II
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)