• Gene id: 6405

Gene Summary

• Gene Symbol: SEMA3F   Gene   UCSC   Ensembl
• Aliases: SEMA-IV, SEMA4, SEMAK
• Gene name: semaphorin 3F
• Alternate names: semaphorin-3F, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, 3F, semaphorin III/F, semaphorin IV,
• Gene location: 3p21.31 (50155057: 50189074)     Exons: 23     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the semaphorin III family of secreted signaling proteins that are involved in axon guidance during neuronal development. The encoded protein contains an N-terminal Sema domain, an immunoglobulin loop and a C-terminal basic do
• OMIM: 601124

Protein Summary

• Protein general information: Q13275  
  • Name: Semaphorin 3F (Sema III/F) (Semaphorin IV) (Sema IV)
  • Length: 785  
  • Mass: 88381
  • Tissue specificity: Expressed abundantly but differentially in a variety of neural and nonneural tissues. There is high expression in mammary gland, kidney, fetal brain, and lung and lower expression in heart and liver.
• Sequence:

  MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKD
  YVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRR
  AQATPWTQTQAVRGRGSRATDGALRPMPTAPRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYID
  FMGTDAAIFRTLGKQTAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
  LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFTSSGSVFRGSAVCVYS
  MADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPSMKSTKDYPDEVINFMRSHPLMYQAVYPLQR
  RPLVVRTGAPYRLTTIAVDQVDAADGRYEVLFLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTI
  SSKRQQLYVASAVGVTHLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
  FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTEQGLLLRALQLSDRGL
  YSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSMSAPPPPGAGPPTPPYQELAQLLAQPEVGLIHQYCQGYW
  RHVPPSPREAPGAPRSPEPQDQKKPRNRRHHPPDT

• Structural information:
  • Protein Domains: (31..54-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (605..69-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR016201  IPR001627  IPR036352  IPR027231  
  • Prosite: PS50835 PS51004
  • STRING: ENSP00000002829
• Other Databases: GeneCards:  SEMA3F  Malacards:  SEMA3F

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0001755	neural crest cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0045499	chemorepellent activity	IDA	molecular function
GO:0007411	axon guidance	IDA	biological process
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0097490	sympathetic neuron projection extension	IEA	biological process
GO:0061549	sympathetic ganglion development	IEA	biological process
GO:0048846	axon extension involved in axon guidance	IEA	biological process
GO:0045499	chemorepellent activity	IEA	molecular function
GO:0036486	ventral trunk neural crest cell migration	IEA	biological process
GO:1902287	semaphorin-plexin signaling pathway involved in axon guidance	IEA	biological process
GO:1902285	semaphorin-plexin signaling pathway involved in neuron projection guidance	IEA	biological process
GO:1901166	neural crest cell migration involved in autonomic nervous system development	IEA	biological process
GO:0097491	sympathetic neuron projection guidance	IEA	biological process
GO:0050919	negative chemotaxis	IEA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IEA	biological process
GO:0021785	branchiomotor neuron axon guidance	IEA	biological process
GO:0021675	nerve development	IEA	biological process
GO:0021637	trigeminal nerve structural organization	IEA	biological process
GO:0021612	facial nerve structural organization	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0001755	neural crest cell migration	IEA	biological process
GO:0048846	axon extension involved in axon guidance	ISS	biological process
GO:0061549	sympathetic ganglion development	ISS	biological process
GO:0097490	sympathetic neuron projection extension	ISS	biological process
GO:0021675	nerve development	ISS	biological process
GO:0097491	sympathetic neuron projection guidance	ISS	biological process
GO:1902285	semaphorin-plexin signaling pathway involved in neuron projection guidance	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq