• Gene id: 6404

Gene Summary

• Gene Symbol: SELPLG   Gene   UCSC   Ensembl
• Aliases: CD162, CLA, PSGL-1, PSGL1
• Gene name: selectin P ligand
• Alternate names: P-selectin glycoprotein ligand 1, cutaneous lymphocyte-associated associated antigen,
• Gene location: 12q24.11 (108633893: 108621894)     Exons: 3     NC_000012.12
• Gene summary(Entrez): This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte tr
• OMIM: 606404

Protein Summary

• Protein general information: Q14242  
  • Name: P selectin glycoprotein ligand 1 (PSGL 1) (Selectin P ligand) (CD antigen CD162)
  • Length: 412  
  • Mass: 43201
  • Tissue specificity: Expressed on neutrophils, monocytes and most lymphocytes.
• Sequence:

  MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGP
  GTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATE
  AQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQ
  TTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
  SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPTEMVCISSLLPDGGEG
  PSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP

• Structural information:
  • Interpro: IPR026195  
  • PDB: 1G1S
  • PDBsum: 1G1S
  • DIP: 37668
  • STRING: ENSP00000228463
• Other Databases: GeneCards:  SELPLG  Malacards:  SELPLG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050901	leukocyte tethering or rolling	IBA	biological process
GO:0030097	hemopoiesis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0050902	leukocyte adhesive activation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	NAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0071354	cellular response to interleukin-6	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0050900	leukocyte migration	IDA	biological process
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0050901	leukocyte tethering or rolling	IDA	biological process
GO:0001931	uropod	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0050901	leukocyte tethering or rolling	IBA	biological process
GO:0030097	hemopoiesis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0050902	leukocyte adhesive activation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	NAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0071354	cellular response to interleukin-6	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0050900	leukocyte migration	IDA	biological process
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0050901	leukocyte tethering or rolling	IDA	biological process
GO:0001931	uropod	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Carotid artery disease	PMID:22307784
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881